close all open/close all

CDS information : Pact_00250


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction36,946 / 37,626 / + [in whole cluster]
36,946 / 37,626 / + [in contig]
Location36946..37626 [in whole cluster]
36946..37626 [in contig]
TypeCDS
Length681 bp (226 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Producthistidine phosphatase family protein
Product (GenBank)putative phosphatase
GenepctX
ptmV
Gene (GenBank)pctX
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)
Family/Domain
FD
IPR013078

close this sectionSequence

selected fasta
>histidine phosphatase family protein [putative phosphatase]
MTLMAYGEQPLTRVLLVRHAQSHASVRKVVAGAATCEGLTEHGREQAGRLAARLAAERLR
PDALLTSPVRRARETATVLAAGLGLPEPVVEPEVRELDFGAADGLSIDEYGRRHGTFDMT
AEPDRPFAPGGESWSGFRGRAGRVMGELADRYPGGTVLVVCHAGLIVAATSGLLDVAPPV
LFTDASPAATSVNEFVRSDTGWSLLRFDDAAHLEGAAGPLPGEPVR
selected fasta
>histidine phosphatase family protein [putative phosphatase]
ATGACGCTGATGGCGTACGGAGAACAACCCCTCACGCGCGTGCTGCTGGTGCGGCACGCC
CAGTCCCACGCCAGTGTCCGGAAGGTCGTGGCCGGCGCCGCGACCTGCGAGGGCCTCACG
GAACACGGCCGTGAACAGGCCGGACGCCTGGCCGCCCGGCTGGCCGCCGAACGGCTGCGC
CCGGACGCCCTGCTGACCAGCCCGGTCCGCCGGGCCCGGGAGACCGCCACCGTCCTCGCG
GCCGGCCTCGGCCTGCCGGAACCGGTGGTCGAGCCCGAGGTGCGGGAACTGGACTTCGGC
GCGGCGGACGGCCTGTCGATCGACGAGTACGGCCGCCGCCACGGCACCTTCGACATGACC
GCCGAGCCCGACCGGCCCTTCGCCCCCGGCGGCGAGAGCTGGTCCGGGTTCCGCGGCCGG
GCCGGCCGGGTGATGGGCGAGCTGGCCGACCGGTACCCGGGCGGCACCGTCCTGGTGGTC
TGCCACGCCGGCCTCATCGTCGCCGCCACCTCCGGGCTGCTGGACGTCGCCCCGCCGGTC
CTCTTCACCGACGCCTCCCCGGCCGCCACGTCCGTCAACGAGTTCGTCCGCTCCGACACC
GGCTGGAGCCTGCTCCGGTTCGACGACGCCGCGCACCTGGAAGGAGCCGCCGGGCCGCTG
CCGGGCGAACCGGTGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013078 Histidine phosphatase superfamily, clade-1 (Domain)
 [13-166]  4.40000000000001e-26 PF00300
PF00300   His_Phos_1
 [13-169]  9.30000048475975e-18 SM00855
SM00855   PGAM
SignalP
 [1-24]  0.212 Signal
Bacteria, Gram-negative   
 [1-33]  0.303 Signal
Bacteria, Gram-positive   
TMHMM No significant hit