close all open/close all

CDS information : Pact_00270


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction40,102 / 41,397 / + [in whole cluster]
40,102 / 41,397 / + [in contig]
Location40102..41397 [in whole cluster]
40102..41397 [in contig]
TypeCDS
Length1,296 bp (431 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)integral membrane protein
Geneorf3
ptmX
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf3
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein [integral membrane protein]
MRTPDGGGGGGGGGDRPRGRGARRGGGANGREADRERRRNRRFAGWLSAALIAGGVVFDL
LTPRNVSAAPFFAAAPLIAAPFATFAVTAFTAAASVGTALVLMLCHGFDGPHDRTESLFE
FVTVLTVALLALATNRVVRRGGRKLASARGIAAAVQRAVLPVPPAVVGGLGVAARYEAAQ
ADAGIGGDLYAVQETPHGVRAVVGDVRGKGLGAVEAVTVVLGAFREAAEEEPDLEGLAGR
LERALDREGRRRANLDQVEGFTTAVLAEIPPGASTVRLLNRGHPPPLLFLPGGGVRTTEP
AVPAMPLGMRELGEWPDRADELAFPPGATLLLFTDGVTEARDAHGVFYDPAGRLGDRTWP
DPDTLLDALVTDVVRHTGGAAADDMALLAVHRPGESGEPAAEPGPVERNRTGPGNGPGNG
PAPSRDGSGPA
selected fasta
>hypothetical protein [integral membrane protein]
GTGCGGACACCGGACGGCGGGGGCGGTGGGGGCGGCGGCGGTGACCGGCCGCGGGGCCGG
GGCGCCCGCCGGGGCGGCGGTGCCAACGGCCGGGAGGCGGACCGGGAGCGGCGGCGGAAC
CGCAGGTTCGCCGGCTGGCTCTCGGCCGCCCTGATCGCGGGCGGGGTGGTCTTCGACCTG
CTGACCCCGCGGAACGTGTCGGCGGCACCGTTCTTCGCGGCCGCGCCGCTGATCGCGGCC
CCCTTCGCCACCTTCGCCGTCACCGCGTTCACCGCGGCGGCGTCGGTCGGCACCGCCCTG
GTCCTGATGCTCTGCCACGGGTTCGACGGCCCGCACGACCGCACCGAGTCGCTGTTCGAG
TTCGTCACCGTCCTCACCGTCGCGCTGCTGGCCCTCGCCACCAACCGGGTGGTCCGCCGC
GGCGGCCGGAAGCTCGCCTCGGCACGCGGCATCGCGGCGGCGGTGCAGCGGGCGGTGCTC
CCGGTGCCCCCCGCGGTGGTCGGCGGGCTGGGGGTCGCGGCGCGTTACGAGGCGGCGCAG
GCCGATGCGGGCATCGGCGGCGACCTGTACGCGGTGCAGGAGACGCCGCACGGGGTGCGC
GCCGTGGTGGGGGACGTACGGGGCAAGGGGCTGGGCGCGGTGGAGGCCGTCACGGTGGTC
CTCGGCGCCTTCCGCGAGGCGGCCGAGGAGGAGCCCGACCTGGAGGGGCTCGCGGGCCGG
CTGGAACGGGCCCTGGACCGGGAGGGGCGGCGCCGGGCCAACCTCGACCAGGTGGAGGGC
TTCACCACCGCGGTGCTCGCGGAGATCCCGCCGGGCGCCTCCACCGTCCGGCTGCTCAAC
CGCGGGCACCCGCCACCGCTGCTGTTCCTCCCCGGTGGGGGCGTCCGGACCACCGAGCCG
GCCGTTCCGGCGATGCCGCTGGGGATGCGCGAGCTGGGTGAGTGGCCGGACCGCGCGGAC
GAGCTGGCGTTCCCGCCGGGGGCCACGCTGCTGCTCTTCACCGACGGGGTGACCGAGGCC
CGGGACGCGCACGGCGTCTTCTACGACCCGGCCGGCCGGCTGGGGGACCGGACCTGGCCG
GACCCGGACACCCTGCTGGACGCGCTGGTCACCGATGTCGTCCGGCACACCGGGGGAGCG
GCGGCGGACGACATGGCGCTGCTCGCCGTCCACCGCCCGGGGGAGTCCGGGGAGCCGGCG
GCAGAACCCGGCCCGGTGGAACGGAACCGGACCGGCCCCGGGAACGGTCCCGGGAACGGT
CCCGCCCCGAGCCGGGACGGTTCCGGCCCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001932 Protein phosphatase 2C-like (Domain)
 [170-394]  4.39999967439747e-08 SSF81606
SSF81606   PP2C-related
 [196-392]  1.70000000000001e-42 PF07228
PF07228   SpoIIE
 [167-392]  1.39999892049878e-32 SM00331
SM00331   PP2C_SIG
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [43-62]  Transmembrane (i-o) [82-104]  Transmembrane (o-i) [117-134]  Transmembrane (i-o)
Transmembrane 3