close all open/close all
Pact_00270 Pact_00270   last last

CDS information : Pact_00280


close this sectionLocation

Organism
StrainATCC 27456 (=NBRC 13433)
Entry namePactamycin
Contig
Start / Stop / Direction41,963 / 42,898 / + [in whole cluster]
41,963 / 42,898 / + [in contig]
Location41963..42898 [in whole cluster]
41963..42898 [in contig]
TypeCDS
Length936 bp (311 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein(fragment)
Product (GenBank)probable peptidase
Geneorf4
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in pactamycin biosynthesis.
Note (GenBank)
  • orf4
Reference
ACC
PmId
[17827660] Cloning of the pactamycin biosynthetic gene cluster and characterization of a crucial glycosyltransferase prior to a unique cyclopentane ring formation. (J Antibiot (Tokyo). , 2007)
Related Reference
ACC
B7TWN2
PmId
[19670201] Deciphering pactamycin biosynthesis and engineered production of new pactamycin analogues. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein(fragment) [probable peptidase]
MASNRSALDEAPYGSLTGPADGADPATATLTAGEPAGGEWNPTAESLAPVRRRHRVVKQR
GTMARSGAVLGVGVIAAVGAGGMATAKDRPNPPISMPDLAHLADDVTDALPAVQDLPGIG
PLLAGESGEETAGAVPAHGSPQPFSQVGLTAQDRANGTTDAGEALRARIMRQAEQQQTAA
DEAEREAAVRAATEAASEAAAEQKAQEEAEREAAAKEAERKAAAEAERKAAEAKRKAAEA
ERKAEADRLAELAGSYALPLSSYTLTSTFGEAGDMWSANHTGQDFAAPTGTPVKAVHGGT
ITEAGWAGAYGT
selected fasta
>hypothetical protein(fragment) [probable peptidase]
GTGGCGTCCAACAGGTCTGCCCTTGACGAGGCACCGTACGGCTCCCTCACCGGACCGGCC
GACGGCGCCGACCCCGCGACCGCCACCCTGACCGCCGGCGAACCGGCGGGCGGCGAGTGG
AACCCCACTGCCGAGTCGCTCGCCCCGGTGCGCCGCAGGCACCGGGTGGTGAAGCAGCGC
GGCACCATGGCACGGAGCGGCGCGGTCCTCGGCGTCGGCGTGATCGCCGCGGTCGGCGCG
GGCGGCATGGCGACCGCCAAGGACCGTCCCAACCCGCCGATCTCGATGCCGGACCTCGCG
CACCTCGCCGACGACGTGACGGATGCGCTCCCCGCCGTGCAGGACCTGCCCGGCATCGGG
CCGCTCCTCGCCGGGGAATCCGGCGAGGAGACCGCCGGCGCCGTGCCGGCCCACGGCTCC
CCCCAGCCCTTCTCCCAGGTCGGGCTCACCGCCCAGGACCGCGCCAACGGCACCACCGAC
GCGGGCGAGGCACTGCGGGCCCGGATCATGCGCCAGGCCGAGCAGCAGCAGACCGCGGCC
GACGAGGCCGAGCGCGAGGCGGCGGTGCGGGCGGCCACCGAGGCGGCGAGCGAGGCCGCG
GCGGAACAGAAGGCGCAGGAGGAGGCCGAGCGTGAGGCCGCCGCGAAGGAGGCCGAGCGC
AAGGCGGCGGCCGAGGCCGAACGGAAGGCGGCCGAGGCGAAGCGCAAGGCGGCGGAGGCC
GAACGGAAGGCGGAGGCCGACCGGCTGGCCGAACTCGCCGGCTCCTACGCGCTGCCCCTG
TCCTCCTACACCCTCACCTCCACCTTCGGTGAGGCCGGCGACATGTGGTCGGCGAACCAC
ACCGGTCAGGACTTCGCCGCGCCCACCGGCACCCCGGTGAAGGCGGTGCACGGCGGCACC
ATCACCGAAGCCGGCTGGGCGGGCGCCTACGGTACC

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011055 Duplicated hybrid motif (Domain)
 [168-311]  1.29999924468179e-14 SSF51261
SSF51261   Dup_hybrid_motif
IPR016047 Peptidase M23 (Domain)
 [279-311]  7.90000000000001e-07 PF01551
PF01551   Peptidase_M23
SignalP
 [1-22]  0.035 Signal
Eukaryota   
 [1-25]  0.099 Signal
Bacteria, Gram-positive   
TMHMM
 [64-86]  Transmembrane (i-o)
Transmembrane 1   
Pact_00270 Pact_00270   last last