close all open/close all
first first   Phosl_00020 Phosl_00020

CDS information : Phosl_00010


close this sectionLocation

Organism
StrainHK803
Entry namePhoslactomycin
Contig
Start / Stop / Direction2,826 / 1 / - [in whole cluster]
2,826 / 1 / - [in contig]
Locationcomplement(1..2826) [in whole cluster]
complement(1..2826) [in contig]
TypeCDS
Length2,826 bp (941 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)PlmR5
Gene
Gene (GenBank)plmR5
EC number
Keyword
Note
Note (GenBank)
  • transcriptional regulator
Reference
ACC
PmId
[12819191] Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster. (J Biol Chem. , 2003)
Family/Domain
FD
IPR000792

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [PlmR5]
MERRASLVGRDHQVGVVADALRPAGTARTLLVTGEAGAGKTAVLDEARYAVVQEGAKVLR
LSWETATGTTGAATLADAVCGVLAEIQHARLPAHITAVRRAQSRSGDGGELTLLSTLGET
LADAACHVPFALVLDGVERMHPPTASALQLMLRVFRPAGLPVVMAGRPVPRGPAGAPDLA
TAADRVLDLPPLRPEDVGELVGQRLGRPAEPALLAAVRRSLGPLAGSPAAVLSVLTALDE
DDGLVDLDGRACLAGTEDGLRLTVDAEPLRRVTADGTDAAVALAGLLHRAELRLEDLHRL
IPACAVLAADLGRTVDRLVRERALTIDGDGRLAFAVPALAAALRTLPPRRDVRSMHAAVV
RTVAERLGPAATGACHPLLADHVVAAGPALNDGVAVPLLLAAAAKDARSYHPRGARAYLS
VLRRLPPNYPATLGVLREAAELGLWCGDHAHVLGLGEPILTSLRDPGPTDGGGLEFATHA
WGLSALHEHRSPYDDGAVAREVFARMPRAAMLAALGGRYGIGPLTPWPSSAEPAPDSGRL
HDGHGPLPSWAELRTLAAAAGGHEELARAVHGLQREELCEAAIGRLRDAAAYGDLAGALE
TVLGERYVHAGHSAAGRYHAMVRDYLAGRWDDALSAARGIERRSGAPGGPGGQLARALAA
EIHCFRGDLVRAREWLDLIPGTVVHPLVARARLGVRYWSGQQDAALEEAWQDVRRARDSG
LLAGTERVLMRILEFAEETRPRQARQALEQLAALHAEADTAMTREALLVGRGVLDGDADG
AHDAYRSAERRGDRHMMLYCCQILADVGDDPQPWLAEAARHMHVLSVGRPGRARLGRSAQ
RRNVPLPRGRSAREGLSEADVQLIRMVGEGGTNRQIAARLACSEKTVEQRLARLFQRTGR
RSRVELVAAWLDGSLAGLGPVPDVPPGGAPGPGAGSGQAGG
selected fasta
>putative LuxR family transcriptional regulator [PlmR5]
GTGGAACGCCGTGCATCTCTCGTCGGCAGGGACCACCAAGTCGGCGTGGTCGCCGACGCC
CTGCGTCCGGCCGGTACGGCGCGGACCCTGCTCGTGACCGGCGAGGCCGGAGCGGGCAAG
ACCGCCGTGCTGGACGAGGCGCGGTACGCGGTGGTCCAGGAGGGGGCCAAGGTGCTGCGG
TTGTCCTGGGAGACCGCCACCGGGACGACCGGTGCCGCCACCCTTGCCGACGCCGTCTGC
GGCGTGCTCGCCGAGATCCAGCACGCCCGGCTCCCGGCCCACATCACCGCCGTGCGCCGG
GCGCAGTCGCGTTCCGGTGACGGCGGCGAACTGACACTACTGTCCACGCTGGGCGAGACC
CTCGCGGACGCGGCGTGCCACGTGCCGTTCGCCCTCGTCCTCGACGGCGTCGAGCGCATG
CACCCGCCGACCGCGTCCGCGCTCCAGCTGATGCTGCGCGTGTTCCGGCCCGCGGGCCTG
CCGGTGGTGATGGCCGGGCGCCCGGTGCCCCGGGGCCCGGCAGGCGCGCCCGACCTGGCG
ACGGCGGCCGACCGGGTGCTCGACCTGCCGCCGCTGCGGCCGGAGGACGTCGGCGAGCTC
GTCGGACAGCGCCTCGGCCGTCCCGCCGAACCCGCGCTGCTCGCGGCGGTGCGGCGCTCC
CTCGGCCCCCTGGCCGGCAGCCCCGCGGCCGTGCTGTCGGTGCTCACCGCGCTGGACGAG
GACGACGGCCTCGTCGACCTCGACGGCCGCGCCTGCCTGGCCGGAACGGAGGACGGCCTG
CGGCTCACCGTGGACGCGGAACCGCTGCGCCGGGTCACCGCCGACGGCACGGACGCCGCC
GTCGCCCTGGCCGGCCTCCTGCACCGCGCGGAACTGCGGCTGGAGGACCTGCACCGCCTG
ATCCCGGCGTGCGCGGTGCTCGCCGCGGACCTCGGCCGGACGGTGGACCGGCTGGTGCGG
GAGCGGGCGTTGACCATCGACGGGGACGGCCGGCTTGCCTTCGCCGTCCCCGCGCTGGCG
GCGGCGCTGCGGACGCTGCCGCCCCGCCGCGACGTCCGCTCGATGCACGCCGCCGTCGTG
CGGACGGTCGCTGAGCGGCTGGGCCCCGCCGCCACGGGCGCCTGCCATCCGCTGCTGGCC
GACCACGTCGTGGCCGCGGGGCCCGCGCTGAACGACGGCGTGGCGGTGCCGTTGCTGCTG
GCGGCCGCCGCCAAGGACGCCCGGTCCTACCACCCGCGGGGGGCGCGGGCCTACCTGTCC
GTGCTGCGCCGTCTGCCGCCCAACTACCCCGCGACGCTGGGCGTGTTGCGCGAGGCCGCC
GAACTGGGACTGTGGTGCGGCGACCACGCCCACGTCCTCGGGCTGGGCGAGCCGATCCTC
ACCAGCCTGCGGGACCCCGGCCCCACCGACGGCGGCGGGCTGGAGTTCGCCACGCACGCC
TGGGGGCTGTCCGCACTGCACGAGCACCGGTCGCCCTACGACGACGGCGCCGTGGCCCGG
GAGGTGTTCGCGCGGATGCCACGGGCTGCGATGCTGGCTGCGCTCGGCGGCCGGTACGGG
ATCGGCCCGCTCACCCCCTGGCCCTCGTCCGCGGAACCCGCCCCGGACAGCGGCCGGCTG
CACGACGGGCACGGCCCGCTGCCGTCCTGGGCCGAGCTGCGGACGCTGGCCGCCGCCGCG
GGCGGCCACGAGGAGCTGGCGAGGGCTGTCCACGGCCTCCAGCGGGAGGAGCTCTGCGAG
GCGGCCATCGGGCGGCTGCGTGACGCCGCGGCCTACGGCGACCTGGCAGGCGCCCTCGAA
ACCGTGCTGGGCGAACGCTACGTACACGCGGGCCACAGCGCCGCCGGCCGCTACCACGCC
ATGGTCCGCGACTACCTGGCCGGGCGCTGGGACGACGCCCTGTCGGCAGCCCGCGGCATC
GAGCGGCGCAGCGGGGCCCCCGGCGGGCCGGGCGGCCAGTTGGCCCGGGCGCTGGCGGCC
GAGATCCACTGCTTCCGCGGTGACCTCGTACGCGCCCGCGAGTGGCTCGACCTCATTCCC
GGCACGGTCGTCCACCCGTTGGTGGCCCGCGCCCGGCTGGGGGTGCGGTACTGGTCGGGA
CAGCAGGACGCGGCGCTGGAGGAGGCATGGCAGGACGTGCGGCGGGCGCGCGACAGCGGC
CTGCTCGCCGGGACCGAGAGGGTGCTGATGCGCATCCTGGAGTTCGCCGAGGAGACCCGG
CCGCGGCAGGCGCGGCAGGCCCTGGAGCAGCTCGCGGCACTGCACGCGGAGGCGGACACG
GCCATGACCCGGGAGGCGCTGCTCGTCGGCCGCGGGGTGCTGGACGGCGACGCGGACGGC
GCGCACGACGCCTACCGCTCGGCCGAGCGGCGGGGCGACCGGCACATGATGCTGTACTGC
TGCCAGATCCTCGCCGACGTCGGCGACGATCCCCAGCCGTGGCTGGCCGAGGCGGCGCGG
CACATGCACGTGCTGTCTGTGGGGCGTCCCGGGCGAGCCCGGCTCGGCAGGTCGGCGCAA
CGCCGTAACGTGCCGCTGCCCAGGGGCCGTTCGGCCCGCGAGGGCCTGAGCGAGGCGGAC
GTGCAGCTGATCCGCATGGTGGGCGAGGGCGGCACCAACCGGCAGATCGCGGCCCGTCTG
GCGTGCAGTGAGAAGACGGTCGAACAACGGCTGGCCCGGCTGTTCCAGCGCACCGGCCGA
CGCTCGCGGGTGGAGCTGGTGGCAGCCTGGCTGGACGGGAGCCTGGCCGGGCTCGGCCCG
GTGCCGGACGTCCCGCCGGGCGGTGCGCCGGGACCGGGAGCGGGGTCCGGCCAGGCCGGC
GGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [856-870]  4.39999967439747e-05 PR00038 [870-886]  4.39999967439747e-05 PR00038 [886-898]  4.39999967439747e-05 PR00038
PR00038   HTHLUXR
 [849-914]  PS50043
PS50043   HTH_LUXR_2
 [870-897]  PS00622
PS00622   HTH_LUXR_1
 [853-910]  3.29999802154459e-14 SM00421
SM00421   HTH_LUXR
 [856-908]  4.6e-09 PF00196
PF00196   GerE
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [838-911]  1e-14 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [834-920]  1.29999924468179e-14 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit
first first   Phosl_00020 Phosl_00020