close all open/close all

CDS information : Phosl_00020


close this sectionLocation

Organism
StrainHK803
Entry namePhoslactomycin
Contig
Start / Stop / Direction2,994 / 5,918 / + [in whole cluster]
2,994 / 5,918 / + [in contig]
Location2994..5918 [in whole cluster]
2994..5918 [in contig]
TypeCDS
Length2,925 bp (974 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)PlmR4
Gene
Gene (GenBank)plmR4
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • transcriptional regulator
Reference
ACC
PmId
[12819191] Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster. (J Biol Chem. , 2003)
Family/Domain
FD
IPR000792

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [PlmR4]
MDSGRGADTGVVRGATATWTDGASWQLVGREQELAELERCLDDPDGPGLVLVHGERGAGR
SAFAHAAAERLAARDHVVLPLVCVRGDQDRPLLLALRVVTAVREHRSVTGRQPAAGRANP
EAEVLAAAERGDRAALADALLFALTHAAPVAVVVDDAQYADAASLGVLGAVAARCPPEVR
LVITSVRHTGGTGDAASGRRQDQAVGLPAEAGTARTIALPRLTRPQLADMVARRSQAAPD
PALVARVLGLTRGIPAAADALLTEWSRRDAVRIADGHAFLAASAPVPVLPDEDRFMRALH
ELGEPCRTTAAALSVLWPLGRTAVALVAGSTGLSDQEVGDGVRRLIAAGLLDELPGEDGG
GPRGWVFRSPLMEHATRERLGPLERARMSAAAVEALWAARDDTAAATSPRRPAVLLEEAD
TVTYLPERMADAGVLIDRERAAAELTAAAEALHPDPEDRGMLRWFRAALRLIEEPAAREL
ALLRCVKAAWVVGDHPAAGQAAETILRDPSDVVSGPDLHELAALQVVAVTSVKDWPHLSR
MGAAEWWDRLPLPPEAALPARALALCMSGRWPEGLDLFSRTEPVWRPDPHIRLIPELAQA
VGNLVQGRTDMLARALETPPDPGLPPEALYSIAAGYTLQLLGNADLCGAMDLLKDRGMPP
EALPPTSHFLLLHLQGRWDDALALARGMVAKDQAFIAPPQHHLFAAGTAAILLARGKPTG
AARLIAGERGTHEGHVEIFLDVAEAAVLRTMGRPDAADRILRRGLREADARGYVYGTDEL
AAALAMLRAEDGRADAAAGCLRRLEELAGRTGSGRTRLLHLLASARVRRQGSGAARELLH
EAVELARSRCQPYETAVTLVAAAGDAGPPELLHEAYELYGETGSLLSRFHTRAAMREAGL
TVPGRRQAAAENEQLLATLVTEGLANRQIATVLRLSQDAVANRLSRLFARTGLRSRTEIV
SAMLTGNPLTAPDL
selected fasta
>putative LuxR family transcriptional regulator [PlmR4]
GTGGACAGTGGCCGGGGGGCGGATACCGGGGTGGTGCGCGGTGCCACGGCGACGTGGACG
GATGGCGCGAGCTGGCAACTGGTGGGTCGCGAGCAGGAGTTGGCAGAGTTGGAACGCTGC
CTGGACGACCCGGACGGTCCCGGCCTGGTGCTCGTCCACGGAGAACGGGGAGCGGGGCGC
AGCGCGTTCGCGCATGCGGCCGCCGAACGGCTGGCTGCGCGGGATCATGTGGTGCTGCCG
TTGGTCTGCGTGCGCGGGGACCAGGACCGTCCGCTCCTGCTGGCGCTGCGGGTGGTCACC
GCCGTGCGGGAGCACCGGTCGGTCACCGGGAGGCAGCCCGCGGCCGGCCGGGCGAACCCG
GAGGCCGAGGTGCTGGCCGCCGCGGAGAGGGGCGATCGGGCGGCGCTCGCCGACGCACTG
CTGTTCGCGCTGACGCATGCGGCGCCCGTGGCCGTGGTGGTGGACGACGCGCAGTACGCC
GACGCGGCATCCCTCGGCGTACTGGGAGCCGTCGCCGCCCGGTGCCCCCCGGAGGTCCGG
CTGGTGATCACGTCGGTACGGCACACCGGCGGGACCGGTGACGCCGCGTCCGGCCGCCGG
CAGGACCAGGCCGTCGGACTGCCGGCGGAAGCGGGCACGGCGCGGACGATCGCCCTGCCG
CGCCTGACCCGGCCGCAGCTCGCCGACATGGTGGCGCGGCGGTCGCAGGCGGCGCCCGAC
CCGGCCCTGGTGGCGCGCGTCCTCGGGCTGACCCGCGGGATTCCCGCAGCCGCCGACGCG
CTGCTCACCGAGTGGTCGCGGCGGGACGCGGTGCGCATCGCCGACGGGCACGCCTTCCTC
GCCGCGAGCGCGCCGGTGCCGGTACTGCCCGATGAGGACCGGTTCATGAGGGCGCTGCAC
GAGCTCGGCGAACCATGCCGGACGACGGCGGCGGCACTGAGCGTCCTGTGGCCGCTCGGC
CGGACGGCGGTGGCGCTGGTGGCCGGGTCCACCGGTCTGTCCGACCAGGAGGTCGGCGAC
GGCGTGCGCCGCCTGATCGCCGCGGGCCTCCTCGACGAACTGCCCGGCGAGGACGGCGGC
GGCCCCCGGGGCTGGGTGTTCCGGTCACCGCTGATGGAGCACGCCACCCGGGAACGGCTC
GGGCCCCTGGAACGCGCCAGGATGTCCGCCGCCGCGGTGGAGGCTCTCTGGGCGGCTCGG
GACGACACGGCCGCAGCGACGTCCCCGCGGCGTCCGGCCGTGCTCCTTGAGGAGGCGGAC
ACCGTGACGTACCTGCCCGAGCGGATGGCCGACGCGGGCGTGCTGATCGACCGCGAGCGC
GCGGCGGCGGAACTCACCGCCGCCGCCGAGGCGTTGCACCCCGACCCCGAGGACCGCGGC
ATGCTGCGGTGGTTCCGGGCGGCGCTGCGCCTGATCGAGGAACCGGCGGCCCGCGAACTG
GCGTTGCTGCGGTGTGTGAAGGCCGCCTGGGTCGTGGGCGACCACCCGGCGGCGGGCCAG
GCGGCGGAGACGATTCTGCGCGACCCCTCCGACGTCGTCAGCGGCCCGGATCTCCACGAG
CTCGCCGCCCTCCAGGTCGTCGCGGTCACCTCCGTGAAGGACTGGCCGCACTTGTCCCGG
ATGGGGGCGGCCGAGTGGTGGGACCGTCTGCCGCTGCCCCCGGAGGCCGCATTGCCGGCG
CGGGCCCTGGCGTTGTGCATGAGCGGGCGGTGGCCGGAGGGTCTGGACCTGTTCTCGCGG
ACGGAGCCGGTGTGGCGCCCGGACCCGCACATCCGGCTGATACCCGAGCTGGCGCAGGCC
GTCGGGAACCTGGTGCAGGGCCGGACCGACATGCTCGCCCGGGCCCTGGAGACACCGCCG
GACCCCGGCCTCCCCCCGGAGGCGCTGTACTCGATAGCAGCCGGGTACACCCTCCAGTTG
CTCGGCAACGCGGACCTGTGCGGCGCCATGGACCTGTTGAAGGACCGCGGGATGCCGCCC
GAGGCGCTTCCCCCCACCAGCCACTTCCTCCTGCTCCACCTCCAGGGCCGGTGGGACGAC
GCGCTGGCGCTGGCGCGCGGCATGGTCGCGAAGGATCAGGCGTTCATCGCGCCGCCCCAG
CACCATCTGTTCGCCGCGGGGACGGCCGCCATCCTGCTGGCCAGGGGCAAGCCGACCGGC
GCCGCCCGTCTGATCGCCGGTGAGCGCGGGACCCACGAGGGTCATGTGGAGATCTTCCTG
GACGTCGCCGAGGCCGCGGTGCTGCGGACCATGGGCCGTCCCGACGCGGCCGACCGCATC
TTGCGGCGCGGGCTGCGGGAGGCCGACGCGCGCGGCTATGTCTACGGAACCGACGAGCTG
GCCGCTGCCCTCGCCATGCTCCGGGCGGAGGACGGCCGGGCCGATGCGGCGGCGGGCTGT
CTGCGGCGCCTGGAGGAACTCGCCGGGCGTACCGGCAGCGGACGCACCCGGCTGCTGCAC
CTGCTGGCATCGGCGCGGGTGCGCCGGCAGGGCTCCGGCGCCGCGCGCGAGCTGCTGCAC
GAGGCGGTGGAGCTGGCCCGCTCGCGGTGCCAGCCGTACGAGACCGCGGTCACGCTGGTG
GCGGCGGCCGGGGACGCGGGCCCCCCGGAGCTGCTGCACGAGGCGTACGAACTGTACGGG
GAGACGGGCTCGTTGCTGAGCCGCTTCCACACCCGGGCCGCGATGCGCGAGGCCGGGCTG
ACCGTCCCCGGCCGCAGACAGGCCGCCGCCGAGAACGAGCAGCTGCTGGCCACCCTGGTT
ACCGAGGGGCTCGCGAACCGCCAGATCGCCACCGTGCTGCGGCTCAGCCAGGACGCCGTC
GCCAATCGCCTGTCACGGCTGTTCGCACGCACCGGTCTTCGGTCTCGTACCGAGATCGTT
TCGGCCATGCTCACCGGCAACCCCCTGACCGCTCCGGACCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [913-961]  2.3e-05 PF00196
PF00196   GerE
 [906-963]  0.0006 SM00421
SM00421   helix_turn_helix, Lux Regulon
IPR011990 Tetratricopeptide-like helical (Domain)
 [905-921]  2.6e-10 G3DSA:1.25.40.10
G3DSA:1.25.40.10   no description
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [922-963]  3.2e-08 G3DSA:1.10.10.10
G3DSA:1.10.10.10   no description
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [887-973]  2.3e-08 SSF46894
SSF46894   C-terminal effector domain of the bipartite response regulators
SignalP No significant hit
TMHMM No significant hit