close all open/close all

CDS information : Phosl_00030


close this sectionLocation

Organism
StrainHK803
Entry namePhoslactomycin
Contig
Start / Stop / Direction6,177 / 6,818 / + [in whole cluster]
6,177 / 6,818 / + [in contig]
Location6177..6818 [in whole cluster]
6177..6818 [in contig]
TypeCDS
Length642 bp (213 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)PlmR3
Gene
Gene (GenBank)plmR3
EC number
Keyword
Note
Note (GenBank)
  • response regulator
Reference
ACC
PmId
[12819191] Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster. (J Biol Chem. , 2003)
Family/Domain
FD
IPR000792

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [PlmR3]
MPEQILTGTVRVAVHSPDAVVHAGLVSSLKHDRRVQEVPAERIHEADAVVAAFDTVDATA
LDRLRALSDRPDTRFLLVAGRHWRADVSAAIDRGVRAVLWRDTFTPSAFVRALLTVADGG
GSFPPTLQGALMEQVRWTHREVLAPRGLTASGVSPRELDVLRLVSEGKELAEIAAKLCYS
ERTVKYILHGLMKRLQLRNRSHAVSYAIRAGLI
selected fasta
>putative LuxR family transcriptional regulator [PlmR3]
ATGCCTGAGCAGATACTCACCGGCACCGTGCGTGTGGCGGTCCACTCACCCGACGCCGTG
GTCCACGCGGGACTTGTCAGCTCCCTCAAGCACGACCGCCGCGTCCAGGAAGTCCCAGCG
GAGAGAATCCACGAGGCCGACGCCGTCGTCGCGGCCTTCGACACCGTCGACGCCACCGCA
CTGGACCGGCTGCGCGCCCTGTCCGACAGGCCCGACACGCGCTTCCTCCTCGTCGCCGGA
CGACACTGGCGAGCAGACGTCTCCGCGGCGATCGACCGGGGAGTGCGCGCCGTGCTGTGG
CGTGACACGTTCACTCCCTCCGCCTTCGTGCGCGCCCTGCTCACCGTCGCGGACGGCGGC
GGCAGCTTCCCGCCCACCCTGCAGGGCGCGCTGATGGAACAGGTCCGGTGGACCCACCGG
GAGGTCCTTGCGCCGCGCGGCCTCACCGCCTCAGGCGTCAGCCCCCGCGAACTCGATGTC
CTCCGCCTGGTCTCGGAGGGAAAAGAACTCGCCGAGATCGCAGCCAAGTTGTGCTATTCG
GAGCGCACCGTGAAGTACATCCTCCACGGCCTGATGAAGCGATTACAGCTGCGCAACCGC
TCGCACGCCGTCTCCTACGCCATCCGCGCCGGCCTCATCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [150-207]  6.90001478563507e-21 SM00421
SM00421   HTH_LUXR
 [153-167]  2.90000036269908e-08 PR00038 [167-183]  2.90000036269908e-08 PR00038 [183-195]  2.90000036269908e-08 PR00038
PR00038   HTHLUXR
 [146-211]  PS50043
PS50043   HTH_LUXR_2
 [154-207]  1.6e-14 PF00196
PF00196   GerE
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [111-213]  1.9e-22 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [131-213]  2.10000267834031e-19 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit