close all open/close all

CDS information : Phosl_00040


close this sectionLocation

Organism
StrainHK803
Entry namePhoslactomycin
Contig
Start / Stop / Direction7,294 / 8,901 / + [in whole cluster]
7,294 / 8,901 / + [in contig]
Location7294..8901 [in whole cluster]
7294..8901 [in contig]
TypeCDS
Length1,608 bp (535 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Producttranscriptional activator
Product (GenBank)PlmR2
Gene
Gene (GenBank)plmR2
EC number
Keyword
  • SARP family
Note
Note (GenBank)
  • transcriptional activator
Reference
ACC
PmId
[12819191] Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster. (J Biol Chem. , 2003)
[16609856] Genetic manipulation of the biosynthetic process leading to phoslactomycins, potent protein phosphatase 2A inhibitors. (J Ind Microbiol Biotechnol. , 2006)

close this sectionSequence

selected fasta
>transcriptional activator [PlmR2]
MEVNFRILGSLQAGVDGAMIPLGGVIKRRLLAYLLLNANRVVATHKLLDVLWPDETPRTA
RKMIGNAVRGLRLDLAHGATDTRAAILTRAPGYQLRVDPDTVDLFLFRRQVERGRTEARG
GDHAAAACTLRGALDLWGGVALADLADGDLNWPELDGLESERLGALEDYFEAGLAIGHHH
EILGELQKAVAEDPLRERLSGQLMVALYRCGRQTDALSVFRRVRTELVERFGLEPSRELR
RLERSVLEHAPDLEVPAAPAAEYHKAPERPTGPALVEQQATRRPDAPDARDASSVSRVPS
RVSRDFRRDHRVAPDRVDDGDRQCTGHRSAPRRTRVSVVLVWVRHDLSDDHDVYGVQKVM
ADIEAVLRQQSTQHGGTMGPVTAPVFSAVFGVDNPRRDDATRAVRTAFALRDRIDDSRPR
ANPSFIRVHVAVVTGDACLLYLPAHSGVPTVTGDVVDRGIRLLAMAPRGQVRVCEVTRQA
TESHITYHPGPEPPDGWEALRIRTGAGHGLQDVRSPEPSEPPDGPGLPQLTARSP
selected fasta
>transcriptional activator [PlmR2]
GTGGAAGTGAACTTCCGTATACTGGGCTCTCTTCAGGCAGGCGTGGACGGCGCGATGATC
CCGCTCGGCGGAGTGATCAAACGCCGGCTGCTCGCCTACCTTTTGCTAAACGCCAACCGG
GTCGTGGCCACACACAAGCTGCTCGACGTCCTGTGGCCGGACGAAACACCCCGCACCGCA
CGCAAGATGATCGGCAACGCCGTCCGAGGCCTGCGGCTCGATCTGGCCCACGGGGCCACG
GACACGCGTGCGGCCATACTGACGCGTGCTCCCGGATACCAGTTGCGGGTCGACCCCGAC
ACCGTGGATCTGTTCCTGTTCCGCCGGCAGGTAGAACGAGGACGCACCGAAGCCCGCGGC
GGCGATCACGCCGCCGCGGCGTGCACGCTGCGGGGGGCGCTCGACCTGTGGGGAGGTGTG
GCACTCGCCGACCTGGCGGACGGCGACTTGAACTGGCCCGAACTGGACGGTCTGGAGAGT
GAGCGACTGGGTGCCCTGGAGGACTATTTCGAAGCCGGACTGGCGATCGGCCACCACCAC
GAGATTCTGGGCGAGCTGCAGAAGGCCGTCGCCGAGGACCCGCTGCGTGAGCGGCTGAGC
GGCCAGCTGATGGTGGCGCTCTACCGGTGCGGTCGGCAGACCGACGCGCTGTCGGTGTTC
CGGCGCGTGAGGACCGAACTCGTGGAACGGTTCGGACTGGAGCCGTCGCGGGAGCTGCGT
CGCCTGGAACGCTCCGTCCTCGAACACGCCCCCGACCTGGAGGTGCCGGCCGCGCCGGCA
GCGGAGTACCACAAGGCGCCCGAGCGGCCAACGGGGCCGGCCCTCGTCGAACAGCAGGCG
ACGCGTCGGCCGGACGCGCCCGACGCCCGTGATGCCTCGTCCGTGAGCCGCGTACCGTCG
CGGGTGAGCAGGGACTTCAGACGCGATCACCGTGTGGCGCCCGACCGCGTGGACGACGGC
GATCGGCAGTGTACGGGCCACCGGTCGGCGCCCCGTCGCACACGGGTGAGCGTCGTCCTG
GTGTGGGTGCGGCACGACCTGTCCGACGACCACGATGTGTACGGCGTGCAGAAGGTCATG
GCGGACATCGAGGCGGTACTGCGGCAGCAATCCACGCAGCACGGGGGGACCATGGGACCG
GTGACGGCACCGGTGTTCTCCGCCGTGTTCGGAGTCGACAACCCCCGCCGGGACGACGCC
ACGCGTGCCGTGCGGACGGCCTTCGCCCTCCGGGACCGGATCGATGACAGCCGGCCGCGT
GCCAACCCGTCCTTCATCCGTGTGCACGTCGCTGTGGTCACCGGTGATGCCTGCTTGTTG
TACCTGCCGGCGCACAGCGGCGTCCCGACAGTCACAGGGGACGTGGTGGACCGGGGCATC
CGGCTGCTGGCGATGGCGCCCCGAGGGCAGGTGCGGGTGTGTGAGGTCACGCGCCAGGCG
ACGGAATCGCACATCACGTACCACCCGGGCCCCGAGCCGCCGGATGGCTGGGAAGCGCTC
CGCATCCGGACCGGCGCAGGTCATGGCCTGCAGGATGTGCGTTCACCGGAGCCGTCCGAG
CCACCGGACGGACCGGGCCTGCCGCAGCTCACGGCTCGATCTCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001054 Adenylyl cyclase class-3/4/guanylyl cyclase (Domain)
 [322-484]  2.00000075217457e-13 SSF55073
SSF55073   A/G_cyclase
 [356-486]  5.5e-06 G3DSA:3.30.70.1230
G3DSA:3.30.70.1230   A/G_cyclase
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [17-95]  1.30000067202732e-06 SM00862
SM00862   Trans_reg_C
 [27-95]  1.1e-07 PF00486
PF00486   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [102-247]  5.6999970878395e-45 SM01043
SM01043   BTAD
 [102-247]  7.79999999999999e-45 PF03704
PF03704   BTAD
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [27-98]  2.5e-08 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [2-96]  1.39999892049878e-13 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-43]  0.254 Signal
Eukaryota   
TMHMM No significant hit