close all open/close all

CDS information : Phosl_00050


close this sectionLocation

Organism
StrainHK803
Entry namePhoslactomycin
Contig
Start / Stop / Direction9,770 / 9,000 / - [in whole cluster]
9,770 / 9,000 / - [in contig]
Locationcomplement(9000..9770) [in whole cluster]
complement(9000..9770) [in contig]
TypeCDS
Length771 bp (256 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)Plm8
Gene
Gene (GenBank)plm8
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
  • thioesterase type II
Reference
ACC
PmId
[12819191] Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster. (J Biol Chem. , 2003)
Related Reference
ACC
Q846W2
NITE
Monen_00290
PmId
[16984884] Identification of NanE as the thioesterase for polyether chain release in nanchangmycin biosynthesis. (Chem Biol. , 2006)
ACC
Q6W5Q5
NITE
FR008_00110
PmId
[18836004] Selective removal of aberrant extender units by a type II thioesterase for efficient FR-008/candicidin biosynthesis in Streptomyces sp. strain FR-008. (Appl Environ Microbiol. , 2008)

close this sectionSequence

selected fasta
>putative type II thioesterase [Plm8]
MSSETATESDRWIRSYLPGPAEALHLVHFPHAGGSASYYRPFCTSLSDRFNALALQYPGR
QDRRDEPCVTDLHVLADLVFDRLRQCADRPMAFFGHSMGALLAFEVTRRFERELNTSPVA
LFLSGRRAPSRHRDENVDLSSNESLLAEIRELSGTDPRLLGDDEMLEMIMEPLRADYRAL
GAYRFVPQPPVRCPVTVLTGADDPRTARDEAAAWQEHTTGDFALRVFPGGHFFISENVAD
VTGFVAERLSAVPLPG
selected fasta
>putative type II thioesterase [Plm8]
TTGAGTTCAGAAACAGCCACCGAGTCGGACCGATGGATCCGCAGCTATCTACCGGGCCCC
GCCGAGGCGCTCCATCTCGTCCACTTTCCCCACGCAGGTGGTTCCGCCAGCTATTACCGG
CCCTTCTGCACCTCCCTGTCGGACCGGTTCAACGCGCTCGCCCTGCAGTATCCGGGGCGT
CAAGACCGGCGCGATGAGCCTTGTGTGACCGATCTGCACGTCCTGGCGGACCTCGTGTTC
GACCGGTTGCGGCAATGCGCGGACCGCCCGATGGCGTTCTTCGGCCACAGCATGGGGGCT
CTCCTGGCGTTCGAGGTGACGCGGAGGTTCGAGCGGGAACTCAACACCTCACCGGTGGCG
CTCTTCCTGTCCGGGCGGCGCGCTCCGTCCCGCCATCGGGACGAGAACGTCGACCTGAGC
AGCAACGAGAGCCTGCTCGCCGAGATCCGGGAGCTGAGTGGCACGGATCCCCGGCTGCTG
GGAGACGACGAGATGCTTGAAATGATCATGGAGCCGCTGCGCGCCGACTACCGAGCCCTG
GGCGCCTACCGGTTCGTGCCACAACCGCCCGTACGCTGCCCGGTCACCGTTCTGACCGGC
GCCGACGACCCCCGTACCGCCCGGGATGAGGCAGCCGCCTGGCAGGAGCACACCACTGGC
GACTTCGCACTGCGGGTGTTCCCCGGTGGTCACTTCTTCATCAGCGAGAACGTCGCCGAT
GTCACCGGCTTCGTCGCCGAGCGGCTCTCCGCTGTCCCACTGCCTGGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [25-246]  1.40000000000001e-56 PF00975
PF00975   Thioesterase
SignalP
 [1-37]  0.092 Signal
Eukaryota   
 [1-36]  0.112 Signal
Bacteria, Gram-positive   
 [1-23]  0.274 Signal
Bacteria, Gram-negative   
TMHMM No significant hit