close all open/close all

CDS information : Phosl_00080


close this sectionLocation

Organism
StrainHK803
Entry namePhoslactomycin
Contig
Start / Stop / Direction20,813 / 25,561 / + [in whole cluster]
20,813 / 25,561 / + [in contig]
Location20813..25561 [in whole cluster]
20813..25561 [in contig]
TypeCDS
Length4,749 bp (1,582 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)Plm6
Gene
Gene (GenBank)plm6
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase type I
Reference
ACC
PmId
[12819191] Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster. (J Biol Chem. , 2003)

close this sectionPKS/NRPS Module

6 ethylmalonyl-CoA
not conserved XAGHS
KS13..382
AT546..861
KR1141..1321
ACP1426..1496

close this sectionSequence

selected fasta
>polyketide synthase [Plm6]
MNRPPNPSRSSAWGAVSPGGVQSPQDLWELVAAEVDAIGPLPADRGWPLDTLYDPDPDRP
GKSYVMESGILHDAAGFDAEFFGISPREARAMDPQHRLLLETSWEALEHAGIPPTSLRGS
TTGVYVGLSPFGYGPQSAEVPADAEGHVVTGGAPAVASGRISYLFGLEGPAMTVDTACSA
GLVALHLAGESLRRDECDLALVAGAAVIATPMVFTEFSKQRALARDGRCKAFSADADGTS
WSEGCGVLVVERLSAARRNGHQVLAVLRGSALNQDGASNGLTAPNGPSQQRVIEAALTAA
RVAADQVDMVEAHGTGTPLGDPIEAQALLATYGQGRGADRPLRLGSLKSNIGHTQAAAGI
AGVIKTVLALRNGVMPKTLHVDRPTTQVDWSAGRVELLREALTWPEVDRPRRAAVSAFGV
SGTNAHVILEYDARPAEPGTGTEAESTAPPASPGPVPVVLSARTSAGLAAQAARLRRHLL
ATPDAEPADVAWSLATTRAHLHHRAAVVAPERTALLADLQCLADGLDLPRNVVTGTVTAS
RKVALMFPGQGSQWPGMARELLASSPVFAESLHECARVIDEMVDWSLIGVVTGADEQRLD
EVDVLQPALFAVMVSLAKLWRSYGIDVHGVVGHSQGEIAAAYVSGALSLADAARIVVTRS
RLLIKVAGRGGALAVGLSAQAATDRITPWNGKLSIAAVNGADSVVVSGEAGALRDFQESC
QADRVWSRRVDVAGIAAHSAEIESVRDELVAALQGIEPREAAVPFYSTVTGTRLTGRELD
PEYWYRNLRETVRFLDITEAMVADGFGFFVEASPHPQLTVGTNQTLKAAESDGTVLGSLR
RDSGGPEQMLLSLAEGYVHGLPVDWTRVLEPGERVPLPTYAFQHEHYWLTAADAVGAVPE
TDARFWDAVEREDLEQLADELGTDAGMAEVLPALARWRREGRRRSRLDSLRYQIAWRAVT
EPPSAAKVPGRWLLVGDDDRTKELARLCEAAEVLSPAGANRAALVERLGGAGPFDAVAYV
GRDAERLLVLVQALGDTDVTAPLWCLTTGAVSTGPSDPPADPHGAALWGLGRVVALERPD
RWGGLVDLPDSLDDRSAGLLAGVLVTAGDEDQLAVRANGVWARRLAHAATATSPGEWKPS
GTVLVTGGTGAIGSAVARWLAEQGGCSLVLLSRRGPDAPGAAELAAELADTGTPVRIIAA
DVADRAAMERVLGDVTEEFGPLRSVFHAAGVPQSTPLEDMTADEFQEVVAAKVDGARVLD
ELLGDTELDAFVVFSSIAAVWGSSRSGAYAAGNASLDALVEQRRARAAAGTSVAWGFWGD
GGMVDAETAPLLRRIGLVPVSPQDGIASLHLALANDDVAVTVAEVDWEPFAATYTAARRR
PLIEDLAEVRQAALRGAAGPQVESVPAEVFRREMRSLGPAERLTAMTDLVRTEAAAQLGW
SDAERIEPHRAFRDLGLDSLASVGLRKRLDGKTGLRTPVTLAFDHPTPAEAAAFLLTLLL
PEGADGDPAVSAESELDRLEAALAGWDAGSVGRARITMRLSSILARWKETGPSAEEDAAD
ADLADASDDDMLDALGREFGIS
selected fasta
>polyketide synthase [Plm6]
GTGAACAGGCCGCCGAACCCCTCGCGATCGTCGGCATGGGGTGCCGTTTCCCCGGGGGGC
GTGCAGTCGCCCCAGGACCTGTGGGAGCTGGTGGCCGCCGAGGTCGACGCCATCGGCCCA
CTGCCCGCCGACCGGGGCTGGCCGCTGGACACCCTTTACGATCCCGACCCGGACCGCCCC
GGCAAGAGCTACGTCATGGAGAGCGGGATTCTGCACGACGCCGCCGGATTCGACGCCGAG
TTCTTCGGGATCTCACCGCGCGAGGCACGGGCGATGGACCCGCAGCACCGGCTGCTGCTC
GAAACATCCTGGGAGGCACTCGAACACGCGGGAATACCGCCGACCTCGCTACGGGGCAGC
ACCACCGGCGTGTACGTCGGGCTGTCGCCCTTCGGCTACGGACCCCAGTCGGCGGAGGTC
CCCGCCGACGCGGAGGGTCACGTCGTGACGGGCGGTGCGCCGGCCGTCGCCTCGGGACGG
ATCTCGTACCTCTTCGGTCTCGAAGGGCCGGCGATGACCGTCGACACCGCCTGCTCGGCG
GGGCTGGTCGCCCTCCATCTGGCCGGTGAGTCGCTGCGCCGGGACGAGTGCGACCTCGCT
CTGGTCGCCGGGGCGGCCGTGATCGCCACCCCGATGGTCTTCACGGAGTTCAGCAAGCAG
CGAGCGCTGGCCCGGGACGGCCGGTGCAAGGCGTTCTCGGCCGACGCGGACGGCACCAGC
TGGTCGGAGGGGTGCGGTGTGCTCGTCGTGGAGCGGCTTTCCGCCGCCCGCCGCAACGGC
CACCAGGTACTGGCCGTCCTCCGGGGCTCGGCCCTCAACCAGGACGGGGCGTCGAACGGC
CTGACGGCACCGAACGGCCCGTCGCAGCAGCGGGTGATCGAGGCCGCGCTCACCGCCGCC
AGGGTCGCCGCCGACCAGGTGGACATGGTGGAGGCGCACGGCACCGGCACCCCGCTCGGC
GACCCCATCGAGGCGCAGGCACTGCTCGCGACGTACGGCCAGGGCCGCGGCGCCGACCGC
CCGCTGCGGCTCGGCTCGCTGAAGTCCAACATCGGCCACACCCAGGCCGCCGCCGGCATC
GCCGGGGTCATCAAGACCGTCCTCGCGCTGCGGAACGGGGTCATGCCCAAGACCCTGCAC
GTGGACCGGCCGACCACCCAGGTCGACTGGTCGGCCGGCCGTGTCGAACTGCTCCGCGAA
GCGCTGACCTGGCCGGAGGTCGACCGGCCTCGCCGGGCCGCGGTGTCCGCGTTCGGTGTG
AGCGGCACCAACGCGCACGTCATCCTCGAATACGACGCTCGCCCCGCCGAGCCCGGCACC
GGCACCGAAGCAGAATCCACCGCACCGCCCGCGTCGCCGGGGCCCGTCCCCGTCGTCCTG
TCGGCCAGGACGTCCGCCGGTCTCGCCGCACAGGCGGCCAGGCTCCGCCGGCACCTGCTG
GCCACGCCCGACGCGGAGCCGGCCGACGTCGCCTGGTCGCTTGCCACGACCCGCGCGCAC
CTGCACCACCGGGCCGCGGTGGTGGCCCCGGAACGTACGGCTCTGCTGGCCGACCTGCAG
TGCCTGGCGGACGGACTCGACCTGCCGCGGAACGTCGTCACCGGCACGGTGACGGCGAGC
CGGAAGGTGGCCCTGATGTTCCCCGGCCAGGGCTCGCAGTGGCCGGGCATGGCCCGCGAA
CTGCTCGCGTCCTCCCCGGTGTTCGCCGAGTCGCTGCACGAGTGCGCCCGCGTGATCGAC
GAGATGGTCGACTGGTCGCTGATCGGCGTCGTGACAGGCGCCGACGAACAGCGCCTGGAC
GAGGTGGACGTCCTGCAGCCCGCGTTGTTCGCGGTCATGGTCTCCCTGGCGAAACTCTGG
CGTTCCTACGGCATCGACGTGCACGGCGTCGTCGGCCACTCCCAGGGGGAGATCGCGGCC
GCGTACGTTTCGGGCGCACTGTCGCTGGCCGACGCCGCACGGATCGTGGTCACCCGGTCC
AGGCTCCTGATCAAGGTCGCCGGCCGCGGTGGCGCCCTGGCGGTCGGGCTCTCCGCGCAG
GCCGCCACGGACCGGATCACGCCGTGGAACGGAAAGCTGTCCATCGCCGCCGTCAACGGG
GCGGATTCGGTCGTCGTCTCGGGCGAGGCCGGGGCGTTGCGCGATTTCCAGGAAAGCTGC
CAGGCCGACCGGGTGTGGTCCCGGCGCGTCGACGTCGCGGGCATCGCCGCGCACTCGGCC
GAGATCGAGTCGGTACGCGACGAACTCGTCGCCGCCCTCCAGGGGATCGAACCGCGCGAG
GCAGCCGTGCCCTTCTACTCGACGGTCACCGGGACCCGGCTCACGGGCCGGGAGCTGGAC
CCGGAGTACTGGTACCGGAACCTGCGGGAGACCGTACGGTTCCTGGACATCACCGAAGCG
ATGGTGGCCGACGGGTTCGGCTTCTTCGTCGAGGCCAGCCCGCACCCGCAGTTGACGGTC
GGCACGAACCAGACGCTCAAGGCCGCCGAGTCCGACGGCACGGTCCTCGGCTCGCTGCGC
CGCGACTCGGGCGGTCCGGAGCAGATGCTGCTCTCCTTGGCGGAGGGTTACGTCCACGGC
CTCCCGGTGGACTGGACCCGCGTCCTGGAGCCGGGCGAGCGGGTGCCGTTGCCGACGTAC
GCCTTCCAGCACGAGCACTACTGGCTCACCGCCGCGGACGCCGTCGGCGCCGTGCCAGAG
ACCGACGCCCGGTTCTGGGACGCCGTGGAGCGCGAGGACCTGGAGCAGCTGGCCGACGAA
CTCGGCACGGACGCGGGCATGGCCGAGGTCTTGCCCGCGCTCGCCCGCTGGCGGCGCGAG
GGGCGGCGCCGGTCGCGCCTGGACTCCTTGCGCTACCAGATCGCCTGGCGGGCCGTCACC
GAACCGCCGTCCGCGGCCAAGGTCCCGGGCCGTTGGCTGCTGGTGGGCGACGACGACCGG
ACCAAGGAGCTGGCGCGGCTGTGCGAGGCGGCCGAGGTGCTGTCCCCGGCCGGCGCGAAC
CGTGCCGCACTCGTCGAACGGCTCGGCGGGGCAGGCCCGTTCGACGCCGTGGCCTACGTC
GGCCGGGACGCCGAACGGCTGCTCGTACTCGTCCAGGCCCTCGGCGACACGGACGTCACC
GCACCCCTGTGGTGTCTGACGACGGGCGCGGTCAGCACCGGCCCGTCCGACCCGCCGGCC
GACCCCCACGGTGCGGCCCTCTGGGGACTCGGCCGGGTCGTCGCGCTGGAACGGCCGGAC
CGCTGGGGTGGCCTGGTGGACCTGCCCGACTCGCTGGACGACCGGAGCGCCGGACTGCTC
GCCGGTGTGCTGGTGACCGCCGGCGATGAGGACCAGCTCGCCGTCCGGGCGAACGGCGTC
TGGGCTCGGCGGCTGGCCCACGCCGCCACCGCCACGTCGCCGGGCGAGTGGAAGCCGTCC
GGCACCGTGCTCGTCACGGGCGGGACGGGTGCCATCGGATCGGCGGTGGCCCGCTGGCTC
GCCGAGCAGGGCGGCTGCTCGCTGGTCCTGCTCTCCCGCCGTGGCCCGGACGCCCCCGGC
GCGGCGGAGCTCGCGGCCGAACTGGCGGACACGGGCACGCCGGTCCGGATCATCGCCGCC
GATGTCGCCGACCGCGCTGCCATGGAGCGGGTGCTGGGCGACGTCACCGAGGAGTTCGGG
CCGTTGCGGTCGGTGTTCCACGCCGCCGGTGTCCCGCAGAGCACCCCGCTGGAGGACATG
ACGGCCGACGAGTTCCAGGAGGTCGTCGCGGCCAAGGTCGACGGGGCCCGGGTGCTCGAC
GAGCTCCTCGGCGACACCGAGCTGGACGCGTTCGTCGTGTTCTCCTCGATTGCCGCGGTC
TGGGGCAGCTCCCGCAGCGGCGCCTACGCCGCCGGCAACGCCTCTCTGGACGCCCTCGTC
GAGCAACGCCGCGCCCGCGCCGCGGCCGGCACCTCGGTCGCCTGGGGATTCTGGGGCGAC
GGTGGCATGGTGGACGCCGAAACGGCCCCGCTGCTGCGTCGCATCGGCCTCGTCCCGGTG
AGCCCGCAGGACGGCATCGCCTCGCTCCACCTCGCCCTCGCGAACGACGACGTGGCGGTG
ACGGTGGCCGAGGTCGACTGGGAGCCGTTCGCCGCCACCTACACCGCGGCCCGGCGCCGC
CCGCTGATCGAGGACCTGGCGGAGGTGCGGCAGGCCGCCCTGCGCGGTGCGGCCGGGCCG
CAGGTGGAGTCCGTACCGGCAGAGGTCTTCCGCCGCGAGATGCGGTCTCTGGGACCGGCG
GAACGGCTGACGGCGATGACCGATCTCGTGCGCACCGAGGCGGCGGCGCAGCTGGGGTGG
AGCGACGCCGAGCGGATCGAACCCCACCGCGCCTTCCGGGACCTCGGTCTGGACTCCCTG
GCCTCGGTCGGCCTGCGCAAGCGGCTGGACGGCAAAACGGGGCTCAGGACTCCGGTGACC
CTCGCGTTCGACCACCCGACGCCCGCCGAGGCCGCCGCCTTCCTGCTCACACTCCTGCTG
CCGGAGGGTGCCGACGGCGACCCGGCGGTGAGCGCCGAGAGCGAACTCGACCGTCTGGAG
GCGGCTCTCGCCGGCTGGGACGCGGGATCGGTCGGCCGGGCCCGGATCACCATGCGCCTG
TCGAGCATCCTCGCCCGCTGGAAGGAGACCGGGCCGTCCGCCGAGGAGGACGCCGCGGAC
GCGGATCTCGCCGACGCCTCCGACGACGACATGCTCGACGCCCTCGGCCGCGAGTTCGGC
ATCTCCTGA
[6] KS13..382
[6] AT546..861
[6] ethylmalonyl-CoA not conserved XAGHS735..739
[6] KR1141..1321
[6] ACP1426..1496
[6] KS37..1146
[6] AT1636..2583
[6] ethylmalonyl-CoA not conserved XAGHS2203..2217
[6] KR3421..3963
[6] ACP4276..4488

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [537-666]  5.99999999999995e-74 G3DSA:3.40.366.10 [735-850]  5.99999999999995e-74 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1454-1469]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1426-1496]  PS50075
PS50075   ACP_DOMAIN
 [1429-1495]  2.9e-10 PF00550
PF00550   PP-binding
 [1417-1503]  1.20000117458134e-20 SSF47336
SSF47336   ACP_like
 [1425-1498]  1.99999999999999e-18 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1141-1320]  2.89999999999999e-63 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [13-256]  3.70000000000004e-84 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [264-382]  9.69999999999989e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [546-861]  1.39999999999997e-95 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [542-831]  3.49999466863949e-68 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [668-733]  2.89999717862184e-13 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [13-268]  2.50000000000001e-80 G3DSA:3.40.47.10 [269-430]  1.5e-62 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [12-431]  6.59996953923913e-92 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1141-1354]  2.29999999999998e-41 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [169-185]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [546-843]  1.19999063421924e-106 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1427-1499]  1.10000150671642e-26 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [14-431]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1141-1321]  5.59999989417026e-55 SM00822
SM00822   PKS_KR
SignalP
 [1-14]  0.524 Signal
Bacteria, Gram-negative   
TMHMM No significant hit