close all open/close all

CDS information : Phosl_00090


close this sectionLocation

Organism
StrainHK803
Entry namePhoslactomycin
Contig
Start / Stop / Direction25,662 / 31,070 / + [in whole cluster]
25,662 / 31,070 / + [in contig]
Location25662..31070 [in whole cluster]
25662..31070 [in contig]
TypeCDS
Length5,409 bp (1,802 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)Plm7
Gene
Gene (GenBank)plm7
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase type I
Reference
ACC
PmId
[12819191] Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster. (J Biol Chem. , 2003)

close this sectionPKS/NRPS Module

7 malonyl-CoA
KS27..405
AT551..852
KR1149..1330
ACP1432..1502
TE1595..1799

close this sectionSequence

selected fasta
>polyketide synthase [Plm7]
MRHFLTELTAELRQAKKRISAYEAEENEPVAIVGMGCRLPGGASNPAELWELVSTGTDAI
GAFPTDRGWDIERLYDPLGEQPGTTRVLEGGFVYNASGFDAGFFGISPREAVGMDPQQRL
LLETTWEALEDAGILPADLRGSRTSVHVGAGTQGYGWNMYADDRDTDAEDHSIIGVTTSL
VSGRIAYTLGLEGAALTIDTACSSSLVALHLACQSLRRGESDLALAGGVTVMAAPSVFVE
FTKQGGLAADGRCKSFSDDADGTGWAEGSGVLVLERLSDARRNGHQVLAVIRGSAVNQDG
ASNGLTAPNGPSQQRVILDALASARLEPRDIDAVEAHGTGTTLGDPIEAQALLATYGRDR
DPAKPLWLGSLKSNIGHSQSASGVLGVIKTVQAMRHTTLPPTLHAATPTTAVDWSAGAVR
LLTESRPWQSEGRPRRAGVSSFGINGTNAHVILEETEAVPEAHEPAPEGPVPLLLSGRSE
QAVRDQAEALRAHLLRRPADELSDVARSLATTRTVFAHRAVVVGETREALLDALPSVTPV
LSGPGRVAGLFSGQGAQRPGMGRELARRFPVFAGVLDEVCAVVDPLLGRSLREVMWSGPA
EQLERTEFAQPALFAFEVAMARLWQSWGVEFSALAGHSVGEIAAAYVAGVLSLPDAARMA
VARARLMQALPEGGAMVAIAASDVEVELLTSGEPAATIAAVNGPEAVVVSGAEAAVLRVA
DYWREQGRRTSRLRVSHAFHSPLMEPMLDDFAAVLGELTFHQPSLPVSPSADTPRPFASA
EYWLDHARHAVRFADAIQEMPAADLFLELGPDAALTPLLDGDRPAVATARRDKPEALTLL
QAAGRAHAHGVALDWPALLGAGRRVPLPTYPFQRQTYWLGGTASPTASNGARSGARNSQE
ERFWAAVAQEDEQTLTSLGAPAELAPALPALARWHRAARWQSTLDSWRYRIVWQPMAEPR
DVAQVPGTWLVVVQSGDDAGETTAALRVLTRILADTVLVETGTDRAEAKAALVDALADAP
MLAGVVSLIQHPDALLTLLQALGDAGTGARLWCLTQGGVGTSDGEAPRSAHAGACWGLGL
VAGLEHPDRWGGLLDLPARLGERATGRLAGILAGDVVEDQVALRDSGVLLRRLVPAPALP
AARAWNPSGTVLITGGTGSLGAHVARWLAERAKCSFVLLSRSGPDAPGAAELVDELEKAG
ARVSVVAADVADHARMSSLAAELAARDEPVRAVFHAAGVGQNTELHGSMTLEEFRTVYSA
KIAGAAVLDEVFDDAEIDLFVLFSSVSGVWGSGRYAGYAAGNAYLDALAQMRRARGLAAT
SVAWGVWADSHMVTPEAEQQYRRRGLIPMPASEAIASLERVLDADELTAVVADMDWDLFM
TGYGAARRRPLLEELPQVRARRPQETTTSAADRNDLRGRLAGLSPAERGTLLDDLVRATL
TEVLGHTDPSAIALDQPLVELGFDSLSAVQVRNKLGLATGLSLPAMLVFDHPTVTAVRDF
LAAELDGAGHDRTAQKTGEGHEDLVSGADESFAAIYRKVALRGRMEEVEDLLGSASGLRA
RFSGASEAPDGTRFVRLATGGQGPAVISFPPFAPVEQTLQFVRLASFFRDRRDLSMVTVP
GFLKGEPLAESVDVLIDVLAESAIHCAAGSPFALLGYSSSGWLAHCVTARMEALGTPAQG
LVLLDTYLPDGMSVALRQAMTYEVNERRSRFTKLNFTTITALGTYRRMFRGWAPQPVSTP
TLFIRPEECIPGDPGLPPLTGEWRTHWPLPHTDATVPGDHCTIVAENADATAALVHDWLD
AL
selected fasta
>polyketide synthase [Plm7]
ATGCGGCATTTCCTCACCGAGCTCACCGCGGAGCTGCGCCAGGCCAAGAAGCGGATCAGC
GCGTACGAGGCCGAGGAGAACGAGCCGGTCGCCATCGTCGGGATGGGCTGCCGGCTGCCC
GGCGGCGCGAGCAACCCGGCCGAGCTGTGGGAACTGGTCTCCACCGGCACGGACGCCATC
GGAGCCTTTCCCACCGACCGCGGCTGGGACATCGAGCGGCTCTACGACCCGCTGGGCGAA
CAGCCCGGCACCACCCGGGTCCTGGAGGGCGGCTTCGTGTACAACGCGAGCGGCTTCGAC
GCGGGGTTCTTCGGCATCTCACCGCGTGAAGCGGTCGGCATGGACCCGCAGCAACGGCTC
CTGCTGGAAACGACCTGGGAGGCGCTGGAGGACGCCGGGATCCTCCCCGCCGACCTCCGC
GGCAGCCGCACCTCGGTCCATGTCGGCGCCGGCACCCAGGGCTACGGCTGGAACATGTAC
GCCGACGACCGGGACACCGACGCCGAGGACCACAGCATCATCGGCGTCACCACCTCCCTC
GTCTCCGGGCGCATCGCCTACACCCTCGGCCTGGAGGGAGCGGCGCTGACCATCGACACG
GCCTGCTCGTCCTCGCTGGTGGCGCTGCACCTCGCCTGCCAGTCGCTACGCCGTGGCGAG
AGCGACCTGGCGCTGGCCGGCGGTGTGACGGTGATGGCGGCGCCGAGTGTGTTCGTCGAG
TTCACCAAGCAGGGCGGCCTGGCCGCCGACGGCCGGTGCAAGTCCTTCTCCGACGACGCC
GACGGTACCGGCTGGGCCGAGGGTTCCGGCGTCCTCGTCCTGGAGCGGCTCTCCGACGCC
CGCCGCAACGGCCATCAGGTCCTTGCCGTGATCCGTGGCTCCGCCGTCAACCAGGACGGT
GCATCCAACGGCCTGACCGCCCCGAACGGTCCTTCCCAGCAGCGCGTCATCCTCGACGCC
TTGGCAAGCGCGCGGCTGGAACCGCGGGACATCGACGCCGTGGAGGCGCACGGAACCGGC
ACGACGCTGGGTGACCCGATCGAGGCCCAGGCACTGCTGGCGACCTATGGCCGGGACCGG
GATCCCGCCAAGCCGCTCTGGCTGGGCTCGCTGAAGTCGAACATCGGGCACAGCCAGTCC
GCGTCGGGCGTGCTGGGCGTCATCAAGACGGTGCAGGCCATGCGGCACACCACCCTGCCG
CCGACCCTCCACGCGGCGACCCCGACCACAGCGGTGGACTGGAGTGCGGGAGCCGTCCGG
CTGCTGACCGAGTCCCGTCCGTGGCAGAGCGAGGGGCGCCCGCGCCGGGCCGGGGTCTCC
TCCTTCGGGATCAACGGCACCAACGCGCACGTCATCCTCGAAGAGACCGAAGCCGTACCC
GAGGCACACGAGCCCGCCCCGGAAGGTCCGGTCCCGCTGCTGCTCTCCGGCCGCTCGGAG
CAGGCGGTGCGGGACCAGGCGGAGGCGCTGCGCGCCCACCTGCTGCGCCGCCCCGCGGAC
GAACTGAGCGATGTGGCCAGGTCATTGGCCACCACGCGGACCGTGTTCGCACACCGCGCC
GTCGTCGTCGGCGAGACCCGGGAAGCCCTGCTCGACGCGCTGCCGTCCGTGACCCCGGTG
CTCTCGGGCCCCGGGCGGGTGGCGGGCCTGTTCTCCGGTCAGGGTGCGCAGCGGCCGGGG
ATGGGGCGTGAGTTGGCGAGGCGTTTCCCGGTGTTCGCCGGGGTGCTGGACGAGGTGTGC
GCGGTGGTCGACCCGTTGTTGGGGCGGTCGTTGCGGGAGGTGATGTGGTCGGGGCCCGCC
GAGCAGCTGGAGCGGACGGAGTTCGCGCAGCCGGCGTTGTTCGCGTTCGAGGTGGCGATG
GCCCGGCTGTGGCAGTCGTGGGGCGTGGAGTTCTCCGCGCTGGCGGGGCATTCGGTGGGA
GAGATCGCCGCCGCGTATGTGGCAGGGGTCCTGTCGTTGCCGGACGCGGCACGGATGGCG
GTGGCACGGGCCCGGTTGATGCAGGCACTGCCGGAGGGCGGGGCCATGGTCGCCATCGCC
GCGAGCGACGTCGAGGTCGAACTCCTCACCTCGGGGGAGCCCGCGGCCACGATCGCCGCG
GTCAACGGCCCGGAGGCGGTGGTGGTCTCCGGTGCCGAGGCAGCCGTCCTGCGGGTCGCG
GACTACTGGCGTGAACAGGGCCGCCGTACCTCCCGGCTGAGGGTGAGCCACGCCTTCCAC
TCACCGCTCATGGAGCCGATGCTCGACGACTTCGCGGCGGTCCTCGGCGAGCTGACCTTC
CACCAGCCGTCCCTCCCCGTCAGCCCGTCGGCCGACACCCCGCGGCCCTTCGCCTCCGCG
GAGTACTGGCTCGACCACGCCCGCCACGCCGTCCGCTTCGCCGACGCGATCCAAGAGATG
CCCGCGGCCGACCTCTTTCTCGAACTGGGACCGGACGCCGCACTGACCCCGCTGCTGGAC
GGGGACCGCCCCGCGGTGGCCACCGCCCGCCGGGACAAGCCCGAGGCGCTCACCCTCCTC
CAGGCCGCGGGCCGGGCACACGCCCACGGTGTGGCGCTGGATTGGCCGGCCCTGCTGGGC
GCCGGACGGCGGGTGCCGCTGCCCACGTACCCCTTCCAGCGCCAGACGTACTGGCTCGGC
GGCACGGCCTCCCCCACCGCCTCGAACGGCGCCCGTTCGGGAGCCCGCAACAGCCAGGAA
GAGCGATTCTGGGCGGCCGTCGCGCAGGAGGACGAGCAGACGCTCACCAGCCTGGGCGCA
CCGGCCGAACTCGCCCCGGCTCTCCCGGCGCTGGCCCGGTGGCACCGTGCGGCCCGGTGG
CAGAGCACGCTCGACTCGTGGCGTTACCGGATCGTCTGGCAGCCGATGGCCGAGCCCCGG
GACGTCGCACAGGTTCCGGGCACCTGGCTGGTGGTGGTGCAGTCGGGCGACGACGCCGGG
GAGACCACCGCGGCGCTGCGCGTCCTGACGCGGATCCTCGCCGACACGGTGCTCGTGGAA
ACCGGGACCGACCGCGCGGAAGCAAAGGCAGCGCTGGTCGACGCCCTGGCCGACGCGCCC
ATGCTGGCCGGAGTGGTCAGTCTGATCCAGCACCCGGACGCGCTCCTGACCCTCCTGCAG
GCACTCGGCGACGCGGGGACGGGGGCCCGGCTGTGGTGCTTGACCCAGGGCGGGGTGGGC
ACGAGCGACGGCGAAGCGCCGCGCAGCGCCCACGCGGGGGCGTGCTGGGGACTCGGTCTG
GTCGCCGGCCTCGAACACCCTGACCGCTGGGGCGGTCTGCTCGACCTGCCGGCCCGGCTC
GGCGAGCGCGCCACCGGCCGGCTCGCCGGCATCCTCGCGGGCGACGTGGTCGAGGATCAG
GTGGCGTTGCGGGACAGCGGCGTGCTGCTGCGCCGGCTGGTGCCGGCTCCCGCCCTGCCC
GCGGCCCGTGCCTGGAACCCGTCCGGCACCGTGCTGATCACCGGCGGCACCGGCTCACTC
GGCGCGCACGTGGCCCGCTGGCTCGCTGAGCGCGCCAAGTGCTCCTTCGTCCTGCTCTCC
CGCAGCGGGCCCGACGCGCCCGGGGCCGCTGAACTCGTCGATGAGCTGGAGAAAGCCGGC
GCCCGGGTCAGCGTCGTCGCAGCCGACGTCGCGGACCACGCGCGGATGTCCTCCCTGGCG
GCCGAACTCGCAGCGAGGGACGAACCGGTGCGTGCGGTCTTCCACGCCGCAGGCGTCGGC
CAGAACACCGAGCTGCATGGCAGTATGACTCTGGAGGAGTTCCGGACCGTCTACTCCGCC
AAGATCGCCGGCGCCGCAGTGCTCGACGAGGTGTTCGACGATGCGGAGATCGACCTGTTC
GTCCTCTTCTCGTCCGTCTCCGGGGTATGGGGCAGCGGTCGCTACGCCGGCTATGCCGCG
GGCAACGCCTACCTCGACGCCCTCGCCCAGATGCGCCGCGCCCGCGGGCTGGCCGCGACG
TCCGTCGCGTGGGGAGTGTGGGCGGACTCCCACATGGTCACCCCCGAGGCCGAACAGCAG
TACCGGCGACGCGGCTTGATACCGATGCCCGCGTCCGAGGCGATCGCCTCGCTGGAACGG
GTTCTCGACGCCGACGAGCTCACGGCAGTCGTGGCCGACATGGACTGGGACCTCTTCATG
ACCGGCTACGGCGCGGCTCGTCGGCGCCCGTTGCTGGAGGAGCTGCCGCAGGTGCGGGCG
CGGCGTCCGCAGGAGACGACCACCTCCGCCGCAGACCGGAACGACCTGCGGGGCAGGCTC
GCCGGGCTGTCGCCGGCCGAGCGGGGGACCCTCCTGGACGACTTGGTGCGCGCCACTCTC
ACCGAGGTGCTCGGTCACACCGACCCGTCCGCCATCGCTCTGGACCAGCCCCTGGTGGAA
CTCGGCTTCGACTCGCTCTCCGCCGTGCAGGTGCGCAACAAGCTGGGCCTCGCCACCGGG
CTCTCGCTGCCCGCGATGCTCGTCTTCGACCACCCCACGGTGACCGCCGTACGCGACTTC
CTGGCTGCCGAGCTCGACGGCGCGGGCCACGACCGGACGGCACAGAAGACGGGTGAGGGG
CACGAGGACCTGGTGTCCGGCGCTGACGAGTCCTTCGCCGCCATTTACCGCAAGGTCGCG
CTGCGGGGTCGTATGGAGGAGGTCGAAGACCTACTCGGCAGCGCGTCAGGCCTGCGTGCG
CGCTTCTCCGGTGCTTCCGAGGCTCCGGACGGCACTCGCTTCGTACGGCTCGCCACCGGC
GGGCAGGGGCCCGCTGTCATCAGTTTCCCGCCGTTCGCACCGGTGGAGCAGACCCTGCAG
TTCGTCCGCCTGGCCAGCTTCTTCCGTGACCGACGGGATCTGAGCATGGTGACCGTGCCG
GGCTTCCTGAAAGGCGAACCGCTGGCCGAGAGCGTCGATGTGCTCATCGACGTCCTGGCC
GAGTCGGCCATTCACTGCGCGGCCGGCTCGCCCTTCGCACTGCTGGGGTACTCGTCGAGC
GGCTGGCTCGCGCACTGCGTCACGGCCCGTATGGAAGCTCTCGGCACCCCGGCCCAGGGG
CTGGTGCTGCTCGACACCTACCTCCCCGACGGTATGTCGGTGGCACTGCGCCAGGCGATG
ACGTACGAGGTGAACGAGCGGCGGTCGCGGTTCACCAAGCTGAACTTCACGACGATCACC
GCACTCGGTACCTACCGCAGGATGTTCCGCGGCTGGGCCCCGCAGCCGGTCTCCACGCCG
ACGCTGTTCATCCGGCCCGAGGAGTGCATCCCCGGCGATCCCGGACTCCCGCCGCTCACC
GGGGAGTGGCGCACGCACTGGCCGCTGCCGCACACCGACGCGACGGTCCCGGGCGACCAC
TGCACGATCGTCGCGGAGAACGCCGACGCCACCGCGGCCCTGGTCCACGACTGGCTGGAC
GCCCTCTGA
[7] KS27..405
[7] AT551..852
[7] malonyl-CoA737..741
[7] KR1149..1330
[7] ACP1432..1502
[7] TE1595..1799
[7] KS79..1215
[7] AT1651..2556
[7] malonyl-CoA2209..2223
[7] KR3445..3990
[7] ACP4294..4506
[7] TE4783..5397

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [1595-1799]  1.1e-19 PF00975
PF00975   Thioesterase
IPR001227 Acyl transferase domain (Domain)
 [544-670]  4.59999999999996e-69 G3DSA:3.40.366.10 [737-842]  4.59999999999996e-69 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1460-1475]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1432-1506]  1.69999999999999e-19 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1435-1500]  6.60000000000002e-11 PF00550
PF00550   PP-binding
 [1424-1519]  8.70001261213513e-20 SSF47336
SSF47336   ACP_like
 [1432-1502]  PS50075
PS50075   ACP_DOMAIN
IPR013968 Polyketide synthase, KR (Domain)
 [1149-1329]  3.2e-60 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [27-280]  3.70000000000004e-90 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [288-405]  2.1e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [551-852]  3.09999999999998e-61 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [546-841]  2.1000026783403e-64 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [672-736]  1.39999892049878e-14 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [30-292]  2.39999999999997e-88 G3DSA:3.40.47.10 [293-457]  1.09999999999999e-63 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [20-404]  1.50000965748778e-100 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1149-1373]  4.70000000000003e-35 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [550-833]  6.4999795054176e-105 SM00827
SM00827   PKS_AT
IPR020802 Polyketide synthase, thioesterase domain (Domain)
 [1587-1799]  2.99998750445706e-110 SM00824
SM00824   PKS_TE
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1433-1505]  1.39999892049878e-26 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [30-458]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1149-1330]  4.19999771339582e-48 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit