close all open/close all

CDS information : Phosl_00100


close this sectionLocation

Organism
StrainHK803
Entry namePhoslactomycin
Contig
Start / Stop / Direction31,679 / 33,394 / + [in whole cluster]
31,679 / 33,394 / + [in contig]
Location31679..33394 [in whole cluster]
31679..33394 [in contig]
TypeCDS
Length1,716 bp (571 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative 3-hydroxyacyl-CoA dehydrogenase
putative beta-keto-reductase
Product (GenBank)PlmT8
Gene
Gene (GenBank)plmT8
EC number1.1.1.35
Keyword
  • ethylmalonyl-CoA
Note
Note (GenBank)
  • oxidoreductase
Reference
ACC
PmId
[12819191] Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster. (J Biol Chem. , 2003)
Related Reference
ACC
P52041
PmId
[8655474] Cloning, sequencing, and expression of clustered genes encoding beta-hydroxybutyryl-coenzyme A (CoA) dehydrogenase, crotonase, and butyryl-CoA dehydrogenase from Clostridium acetobutylicum ATCC 824. (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>putative 3-hydroxyacyl-CoA dehydrogenase [PlmT8]
MAKRFSTIAVIGLGTTGSVLASMAARSGRRVIAVDTDASALDLAGARLTDTGPGTIDLTT
RSADIVSADLVIEAVPERMKTKCELLSHAHNACAPGAVFATTTSGLAVTDIAFGSGRPCR
TVGLHLFPQGPMDPATAVEVVGTPLTDGSVLADVQALIRDLGQVPVSVPDRAGFVGGALT
MAYLNDAATMYEQRYASRDGIDTAMRLGCGLPRGPLAHLDAIGLDVARDTLDALHERTGD
RRFLPAPVLTHMVAAGLLGLKAGRGFYDYGAPDADGAADTGDELPTARPARRIGVVGSGT
MATGIAQACARAGYPTTLVARSEVRAKEALATVENSLNRAVQRGRLTPEQLTSSMESLTG
VSRLEAVAACDLVVEAVVEDIDVKRTVFRELDAVCGAQTVLATSTSSLPVIECAMATGRP
EAVVGMHFFNPAPVMKLVEVVRTALTSRETLGVAHATATALGKRPVGCLDRSGFIVNALL
FPYLNRAVALLDEGILTAEGIDTVMALGQGHPMGPLQLLDVIGLDVSVAILRTLHTTFRE
QRLLPSRPLEQLVAAGHLGRKRGKGLRNHEL
selected fasta
>putative 3-hydroxyacyl-CoA dehydrogenase [PlmT8]
ATGGCTAAGCGCTTCTCCACCATCGCGGTGATAGGTCTCGGGACCACCGGGTCGGTGCTC
GCGAGCATGGCCGCCCGCAGCGGCCGCCGGGTGATCGCCGTCGACACCGACGCCTCCGCT
CTGGACCTGGCCGGTGCCCGGCTGACCGACACCGGACCGGGCACGATCGACCTCACCACG
CGCTCGGCCGACATCGTGTCGGCGGACCTGGTGATCGAAGCGGTACCCGAGCGGATGAAG
ACGAAGTGCGAGCTGCTCAGTCACGCGCACAACGCGTGCGCCCCGGGCGCGGTGTTCGCG
ACGACGACCAGCGGACTGGCGGTGACCGACATCGCCTTCGGCTCGGGGCGGCCATGTCGC
ACGGTGGGGCTGCACCTGTTCCCACAGGGGCCGATGGACCCGGCGACCGCCGTGGAGGTC
GTGGGTACGCCCCTGACGGACGGGTCCGTACTCGCGGACGTCCAAGCACTGATTCGAGAC
CTCGGGCAGGTCCCGGTGTCGGTGCCCGATCGCGCGGGCTTCGTCGGCGGGGCCCTGACT
ATGGCCTATCTCAACGACGCCGCGACGATGTACGAACAGCGCTACGCCTCGCGCGACGGC
ATCGACACCGCCATGAGGCTGGGCTGCGGGCTTCCGCGAGGGCCGCTGGCTCACCTGGAC
GCGATCGGGCTGGATGTCGCGCGTGACACGTTGGACGCCCTGCACGAACGCACCGGTGAC
CGCCGGTTCCTGCCCGCCCCCGTACTGACGCACATGGTCGCCGCCGGCCTGCTCGGGCTG
AAGGCCGGGCGTGGCTTCTACGACTACGGCGCCCCGGACGCCGACGGAGCCGCGGACACC
GGCGACGAGCTGCCGACGGCCCGCCCCGCACGGCGTATCGGCGTAGTGGGTTCGGGGACG
ATGGCCACCGGCATCGCGCAGGCCTGCGCACGGGCGGGGTACCCGACGACTCTCGTGGCG
CGCAGCGAGGTCCGCGCCAAAGAGGCGCTCGCCACCGTGGAGAACTCGCTGAACCGGGCG
GTGCAGCGGGGCAGACTGACACCGGAGCAGCTCACCTCGTCGATGGAGTCGCTCACCGGT
GTGTCCCGCCTGGAGGCGGTCGCCGCATGCGATCTCGTGGTCGAGGCGGTCGTGGAGGAC
ATCGACGTCAAGCGGACGGTGTTCCGGGAACTCGACGCCGTATGCGGGGCGCAGACCGTG
CTGGCGACATCCACGTCGAGTCTGCCGGTCATCGAATGTGCCATGGCGACCGGTCGGCCC
GAGGCCGTGGTCGGGATGCACTTCTTCAATCCGGCACCGGTGATGAAACTCGTCGAAGTG
GTGCGGACCGCGCTGACCTCGCGCGAGACACTCGGCGTGGCGCACGCGACCGCCACCGCG
CTCGGCAAGCGTCCTGTGGGCTGTTTGGACCGGAGCGGGTTCATCGTGAACGCGTTGCTG
TTCCCCTATCTGAACAGAGCGGTGGCCCTGCTCGACGAGGGGATCCTCACCGCCGAGGGC
ATCGACACGGTGATGGCCCTGGGACAGGGCCATCCCATGGGCCCGCTCCAGCTGCTGGAC
GTGATCGGTCTGGATGTGTCCGTGGCCATCCTGCGCACGCTGCACACCACGTTCCGGGAG
CAACGCCTCCTGCCCTCGCGCCCTCTTGAGCAGCTCGTGGCGGCCGGCCACCTGGGCCGC
AAGCGGGGCAAGGGACTGCGGAACCACGAGCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006108 3-hydroxyacyl-CoA dehydrogenase, C-terminal (Domain)
 [173-269]  4.9e-24 PF00725 [473-566]  7.20000000000003e-27 PF00725
PF00725   3HCDH
IPR006176 3-hydroxyacyl-CoA dehydrogenase, NAD binding (Domain)
 [7-170]  6.19999999999994e-38 PF02737 [293-470]  1e-57 PF02737
PF02737   3HCDH_N
IPR008927 6-phosphogluconate dehydrogenase, C-terminal-like (Domain)
 [173-270]  4.00000300869883e-27 SSF48179 [473-570]  5.10001002358244e-27 SSF48179
SSF48179   6DGDH_C_like
IPR013328 Dehydrogenase, multihelical (Domain)
 [175-269]  1.80000000000002e-56 G3DSA:1.10.1040.10 [475-565]  1.80000000000002e-56 G3DSA:1.10.1040.10
G3DSA:1.10.1040.10   Opine_DH
IPR016040 NAD(P)-binding domain (Domain)
 [3-174]  1.29999999999998e-83 G3DSA:3.40.50.720 [285-474]  1.29999999999998e-83 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-21]  0.999 Signal
Bacteria, Gram-negative   
 [1-33]  0.998 Signal
Bacteria, Gram-positive   
 [1-21]  0.95 Signal
Eukaryota   
TMHMM No significant hit