close all open/close all

CDS information : Phosl_00110


close this sectionLocation

Organism
StrainHK803
Entry namePhoslactomycin
Contig
Start / Stop / Direction33,459 / 34,805 / + [in whole cluster]
33,459 / 34,805 / + [in contig]
Location33459..34805 [in whole cluster]
33459..34805 [in contig]
TypeCDS
Length1,347 bp (448 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative crotonyl-CoA reductase
Product (GenBank)PlmT7
Gene
Gene (GenBank)plmT7
EC number1.3.1.-
Keyword
  • ethylmalonyl-CoA
Note
Note (GenBank)
  • crotonyl CoA reductase
Reference
ACC
PmId
[12819191] Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster. (J Biol Chem. , 2003)
Related Reference
ACC
Q53865
PmId
[8521864] Purification of crotonyl-CoA reductase from Streptomyces collinus and cloning, sequencing and expression of the corresponding gene in Escherichia coli. (Eur J Biochem. , 1995)
ACC
Q9RNU6
PmId
[10542184] Role of crotonyl coenzyme A reductase in determining the ratio of polyketides monensin A and monensin B produced by Streptomyces cinnamonensis. (J Bacteriol. , 1999)
ACC
B8XVS5
PmId
[17548827] Synthesis of C5-dicarboxylic acids from C2-units involving crotonyl-CoA carboxylase/reductase: the ethylmalonyl-CoA pathway. (Proc Natl Acad Sci U S A. , 2007)
[19458256] Carboxylation mechanism and stereochemistry of crotonyl-CoA carboxylase/reductase, a carboxylating enoyl-thioester reductase. (Proc Natl Acad Sci U S A. , 2009)

close this sectionSequence

selected fasta
>putative crotonyl-CoA reductase [PlmT7]
MREIVSAALSDNAVGADFAALPVPQSYRGAVVLRDESEMFQGMATADKEPTKSLSVREVP
TPEPAPGEALIAVMASSINYNTVWTSLFEPMPTFGFLQRYARSNEPGAERHDQPYHVVGS
DLAGIVLRTGPGVHRWKPGDRVVAHCLSVDLQSPDGHDDTMLDPEQRSWGFETNFGGLAE
LSLVKSNQLMPMPKHLTWEEAAASGLVNSTAYRQLVSRNGGHMKQGDVVLVWGAAGGLGS
YATQLALNGGATPVCVVSGERKAQLVRSLGAELVIDRAKEGYRFWKDESTPDPKEWKRLG
SHIRELTGGEDSDIVFEHPGRETFAASVYVARRGGTVVTCASTSGFRHEYDNRYLWMSLK
RIVGSHFANYREAWAANRLIGRGMIHPTLSTVYPLSDVGIATQAVHRNQHAGKVGVLGLA
PAEGLGVQDEALRERHLAAINRFRSRGS
selected fasta
>putative crotonyl-CoA reductase [PlmT7]
ATGCGGGAGATCGTGAGCGCTGCCCTGTCGGACAATGCGGTCGGTGCGGATTTCGCCGCG
TTGCCGGTTCCGCAGTCCTACCGCGGTGCCGTAGTCCTGCGGGACGAGTCGGAGATGTTC
CAGGGTATGGCGACCGCCGACAAGGAACCCACGAAGTCCCTCAGCGTGCGCGAGGTGCCG
ACTCCCGAGCCCGCTCCGGGCGAGGCCCTCATCGCGGTGATGGCCAGCTCCATCAACTAC
AACACCGTGTGGACCTCCCTCTTCGAGCCGATGCCGACCTTCGGTTTCCTGCAGCGGTAC
GCGCGGTCCAACGAACCTGGCGCGGAGCGACACGATCAGCCCTACCACGTGGTGGGTTCC
GACCTGGCGGGCATCGTGCTGCGTACCGGGCCCGGCGTGCACCGCTGGAAGCCGGGCGAC
CGGGTCGTGGCGCACTGCCTGTCCGTCGACCTGCAGTCCCCGGACGGGCACGACGACACC
ATGCTCGACCCGGAGCAGCGCAGCTGGGGGTTCGAGACCAACTTCGGGGGGCTCGCCGAG
CTGTCCCTCGTCAAGTCCAACCAGCTCATGCCGATGCCCAAGCACCTCACGTGGGAGGAG
GCCGCTGCCTCCGGGCTGGTCAACTCCACCGCCTACCGGCAACTCGTCTCGCGCAACGGT
GGGCACATGAAGCAGGGCGACGTGGTTCTCGTCTGGGGCGCGGCGGGCGGCCTCGGCTCG
TACGCCACGCAGCTCGCCCTCAATGGCGGCGCGACTCCGGTGTGCGTCGTGTCCGGAGAG
CGCAAGGCCCAACTCGTCCGGTCCCTGGGCGCCGAGCTCGTGATCGACCGGGCGAAGGAG
GGGTACCGGTTCTGGAAGGACGAATCCACGCCCGACCCCAAGGAGTGGAAGCGCCTGGGC
TCCCACATCCGGGAGCTGACAGGGGGTGAGGACTCGGACATCGTCTTCGAGCACCCCGGC
CGGGAGACCTTCGCCGCCAGCGTGTACGTGGCGCGGCGCGGCGGCACCGTGGTCACCTGC
GCCTCGACCTCCGGATTCCGGCACGAGTACGACAACCGCTATCTCTGGATGTCGCTCAAG
CGCATCGTCGGCAGCCACTTCGCCAACTACCGGGAGGCCTGGGCGGCCAACCGTCTCATC
GGCAGGGGGATGATCCATCCGACCCTGTCCACGGTGTACCCGCTGTCCGACGTCGGCATC
GCCACGCAGGCCGTGCACCGCAATCAGCACGCCGGCAAGGTCGGAGTGCTGGGCCTGGCG
CCCGCGGAGGGGCTCGGCGTCCAGGACGAGGCGCTGCGGGAGCGCCACCTGGCAGCGATC
AACCGCTTCCGCAGCCGCGGCAGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010085 Crotonyl-CoA reductase (Family)
 [32-428]  TIGR01751
TIGR01751   Crot-CoA-red
IPR011032 GroES-like (Domain)
 [34-234]  3.80000697093586e-31 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [237-380]  8.20000000000006e-35 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [108-191]  2.1e-07 PF08240
PF08240   ADH_N
IPR016040 NAD(P)-binding domain (Domain)
 [234-347]  4.5e-20 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit