close all open/close all

CDS information : Phosl_00120


close this sectionLocation

Organism
StrainHK803
Entry namePhoslactomycin
Contig
Start / Stop / Direction34,851 / 35,081 / + [in whole cluster]
34,851 / 35,081 / + [in contig]
Location34851..35081 [in whole cluster]
34851..35081 [in contig]
TypeCDS
Length231 bp (76 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.5 electron carrier
Productputative ferredoxin
Product (GenBank)PlmT6
Gene
Gene (GenBank)plmT6
EC number
Keyword
Note
Note (GenBank)
  • ferredoxin
Reference
ACC
PmId
[12819191] Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster. (J Biol Chem. , 2003)
Related Reference
ACC
P18325
PmId
[1846297] Ferredoxins from two sulfonylurea herbicide monooxygenase systems in Streptomyces griseolus. (Biochemistry. , 1991)

close this sectionSequence

selected fasta
>putative ferredoxin [PlmT6]
MAFAHVHLDESKCVTSGQCVLTAPEVFDQRETDGVGVVLTDSPAPELRDKVQEAAAGCPA
AAIRLLHRPPGRVAGG
selected fasta
>putative ferredoxin [PlmT6]
ATGGCGTTTGCGCATGTGCACCTCGACGAATCGAAGTGCGTCACCTCGGGGCAGTGCGTC
CTGACCGCCCCCGAGGTGTTCGATCAGCGGGAGACGGACGGTGTCGGCGTCGTGCTGACC
GACTCCCCCGCCCCGGAACTGCGCGACAAGGTGCAGGAGGCCGCGGCCGGCTGCCCCGCG
GCGGCGATCCGACTGCTGCACCGGCCCCCCGGACGGGTGGCCGGCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001080 3Fe-4S ferredoxin (Family)
 [8-19]  2.00000075217457e-06 PR00352 [19-29]  2.00000075217457e-06 PR00352 [51-63]  2.00000075217457e-06 PR00352
PR00352   3FE4SFRDOXIN
SignalP No significant hit
TMHMM No significant hit