close all open/close all

CDS information : Phosl_00130


close this sectionLocation

Organism
StrainHK803
Entry namePhoslactomycin
Contig
Start / Stop / Direction35,291 / 36,238 / + [in whole cluster]
35,291 / 36,238 / + [in contig]
Location35291..36238 [in whole cluster]
35291..36238 [in contig]
TypeCDS
Length948 bp (315 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productaminoglycoside phosphotransferase domain protein
Product (GenBank)PlmT5
Gene
Gene (GenBank)plmT5
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • putative kinase
Reference
ACC
PmId
[12819191] Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster. (J Biol Chem. , 2003)
Family/Domain
FD
IPR002575

close this sectionSequence

selected fasta
>aminoglycoside phosphotransferase domain protein [PlmT5]
MAANSSLPAEPLTDEIPLSLWGRNDLRVLPWERDPVDLGFHSYTYLVGSDSDMYVAKCVP
AAQGPKFTSGLTVALVVEEHGIPAGGPLPTARGEITAYHGEWCWALLRHLDGGRADENDP
VHMRRAGETLGAIHTALVGTPPPPDILSWDHLDVMMVDEAPFLEDKPWIQQAMCEAYETV
AGRVTVGLLHADASMNTFRVKPDSMGLFDWGEVMYGPLLFDVATALSYLDRSVDVGPLLR
GYMAKSPVSPSELPHLGALLKFRAAAEAWIYARREWVGNDIGNIGDLSNANLLDRARKNL
ASAEQDGERFLRQYE
selected fasta
>aminoglycoside phosphotransferase domain protein [PlmT5]
TTGGCAGCCAACAGTTCTCTACCAGCCGAGCCGCTCACCGACGAGATCCCGCTCTCCCTG
TGGGGACGGAACGATCTACGGGTCCTGCCATGGGAACGCGATCCGGTCGACCTGGGCTTC
CACTCCTATACGTATCTGGTCGGATCCGACTCGGACATGTATGTCGCCAAGTGCGTACCC
GCCGCCCAGGGGCCGAAATTCACCAGCGGCCTCACGGTCGCCCTGGTGGTCGAGGAGCAC
GGCATCCCAGCCGGCGGGCCACTTCCGACCGCCCGGGGCGAGATCACCGCCTACCACGGT
GAATGGTGCTGGGCATTGCTGCGTCACCTCGACGGCGGGCGGGCCGACGAGAACGATCCT
GTGCACATGCGCCGGGCCGGCGAGACGCTGGGAGCCATCCATACCGCACTGGTCGGCACC
CCTCCTCCGCCGGACATCCTGAGCTGGGACCACCTGGACGTCATGATGGTCGACGAGGCG
CCGTTCCTCGAGGACAAGCCATGGATCCAGCAGGCCATGTGCGAGGCGTACGAGACGGTG
GCCGGCAGGGTCACGGTGGGCCTGCTGCATGCCGATGCCAGCATGAACACGTTCCGGGTG
AAGCCCGATTCGATGGGGCTCTTCGACTGGGGCGAAGTCATGTACGGCCCCCTCCTCTTC
GATGTCGCCACCGCCCTCAGCTATCTGGACAGGTCCGTGGACGTCGGCCCGCTGCTGCGG
GGATACATGGCGAAGTCCCCGGTGTCCCCGTCGGAACTTCCCCACCTCGGAGCCCTCCTG
AAGTTCCGCGCGGCCGCGGAGGCCTGGATCTACGCCCGACGCGAGTGGGTGGGCAATGAC
ATCGGGAACATCGGCGATCTCAGCAATGCGAACCTCCTCGACCGGGCACGGAAGAACCTC
GCGTCGGCCGAGCAGGACGGCGAGCGTTTCCTGCGCCAGTACGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002575 Aminoglycoside phosphotransferase (Domain)
 [35-231]  3.4e-16 PF01636
PF01636   APH
IPR011009 Protein kinase-like domain (Domain)
 [39-270]  1.2e-11 SSF56112
SSF56112   Protein kinase-like (PK-like)
SignalP No significant hit
TMHMM No significant hit