close all open/close all

CDS information : Phosl_00140


close this sectionLocation

Organism
StrainHK803
Entry namePhoslactomycin
Contig
Start / Stop / Direction36,297 / 37,508 / + [in whole cluster]
36,297 / 37,508 / + [in contig]
Location36297..37508 [in whole cluster]
36297..37508 [in contig]
TypeCDS
Length1,212 bp (403 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)PlmT4
Gene
Gene (GenBank)plmT4
EC number
Keyword
Note
Note (GenBank)
  • cytochrome P450
Reference
ACC
PmId
[12819191] Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster. (J Biol Chem. , 2003)
Related Reference
ACC
Q59831
PmId
[7557483] Cloning, characterization and expression of the gene encoding cytochrome P-450sca-2 from Streptomyces carbophilus involved in production of pravastatin, a specific HMG-CoA reductase inhibitor. (Gene. , 1995)

close this sectionSequence

selected fasta
>putative cytochrome P450 [PlmT4]
MSQLSSELPAFPMSKAKGCPLDPPPEYAQLRSDRPVAKARLWDGKEVWLITGYDEIRSIF
TDPRISVDNTQPGYPWLSEQARTVVLTGGVKPVGRMDPPEHTAMRRMLGQGFLVKKIQNM
RGDVEALVNELIDDILAGPRPTDLVPSLAMPVPSTALGWVLGVPPADKRLISLVPRLFDE
DSGLEGAMEARAELFAYIDELITHRENQPGDDIISHLVGYYQKGELSRVSVLTQSVTLIA
AALDTTRSMITNGILALLQHPEQAAALIEDPDLVPAAVEELLRYTVVTEFSSKRVAAADI
EIAGETIKAGDGIICLISAGNRDEKVFTDPDTLDVRRDAKQHLGFGAGIHTCIGKQLARM
ELEVVYGTLFRRIPELRLAVPFDQLVFRNTFDVQGVRALPVTW
selected fasta
>putative cytochrome P450 [PlmT4]
ATGTCACAGCTCTCGTCCGAACTCCCCGCTTTCCCCATGTCCAAGGCGAAGGGCTGCCCC
TTGGACCCGCCCCCCGAATACGCTCAGTTGCGGTCGGACCGGCCGGTCGCGAAAGCGAGG
CTGTGGGACGGCAAGGAAGTGTGGCTGATCACCGGGTATGACGAGATCCGCTCGATCTTC
ACCGACCCGCGTATCAGTGTCGACAACACGCAGCCCGGTTATCCCTGGCTGAGTGAGCAA
GCGCGGACCGTCGTGCTGACCGGCGGCGTGAAGCCGGTGGGCCGGATGGACCCGCCCGAG
CACACCGCCATGCGGCGCATGCTGGGCCAGGGCTTCCTGGTCAAGAAGATCCAGAACATG
CGCGGTGACGTGGAGGCCCTCGTCAACGAGCTCATCGACGACATTCTCGCGGGTCCTCGG
CCGACGGACCTGGTGCCGTCGTTGGCCATGCCGGTGCCGTCCACCGCACTGGGATGGGTG
CTGGGTGTCCCCCCAGCCGACAAGCGCCTCATCAGCCTGGTTCCCCGGCTGTTCGACGAG
GACTCCGGGCTGGAGGGCGCCATGGAGGCACGCGCCGAACTGTTCGCGTACATCGACGAG
TTGATCACGCACCGGGAGAACCAACCGGGCGACGACATCATCAGCCACCTGGTCGGCTAC
TACCAGAAGGGGGAGCTGTCGCGCGTCTCCGTGCTCACCCAGTCGGTCACGCTGATCGCG
GCGGCACTCGACACCACCAGGAGCATGATCACCAACGGGATCCTGGCCCTGCTGCAGCAT
CCCGAGCAGGCGGCGGCGCTGATCGAGGACCCGGACCTCGTACCGGCGGCGGTCGAGGAA
CTCCTGCGCTACACGGTCGTCACGGAGTTCTCGTCGAAGCGCGTGGCGGCCGCGGACATC
GAGATCGCGGGCGAGACCATCAAGGCGGGTGACGGCATCATCTGCCTGATCAGCGCGGGC
AACCGGGACGAGAAGGTCTTCACCGATCCCGACACCCTGGACGTCCGGCGGGACGCCAAA
CAGCACCTGGGCTTCGGGGCCGGCATCCACACGTGCATCGGGAAGCAACTGGCGCGCATG
GAGCTGGAAGTGGTGTACGGAACCCTGTTCCGCCGGATCCCCGAGCTGCGGCTGGCGGTC
CCCTTCGACCAGCTGGTCTTCCGCAACACGTTCGACGTGCAGGGCGTCCGGGCGCTTCCC
GTCACGTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [241-258]  1.10000029896148e-06 PR00385 [276-287]  1.10000029896148e-06 PR00385 [343-352]  1.10000029896148e-06 PR00385 [352-363]  1.10000029896148e-06 PR00385
PR00385   P450
 [185-372]  6.79999999999998e-24 PF00067
PF00067   p450
 [20-403]  1.60000000000002e-97 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [5-403]  1.50000965748778e-89 SSF48264
SSF48264   Cytochrome_P450
IPR002397 Cytochrome P450, B-class (Family)
 [96-107]  7.6999848053369e-51 PR00359 [143-159]  7.6999848053369e-51 PR00359 [160-175]  7.6999848053369e-51 PR00359 [196-218]  7.6999848053369e-51 PR00359 [276-287]  7.6999848053369e-51 PR00359 [294-321]  7.6999848053369e-51 PR00359 [322-337]  7.6999848053369e-51 PR00359 [343-352]  7.6999848053369e-51 PR00359 [352-363]  7.6999848053369e-51 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [345-354]  PS00086
PS00086   CYTOCHROME_P450
SignalP
 [1-18]  0.149 Signal
Bacteria, Gram-negative   
 [1-28]  0.185 Signal
Bacteria, Gram-positive   
TMHMM No significant hit