close all open/close all

CDS information : Phosl_00150


close this sectionLocation

Organism
StrainHK803
Entry namePhoslactomycin
Contig
Start / Stop / Direction37,722 / 38,933 / + [in whole cluster]
37,722 / 38,933 / + [in contig]
Location37722..38933 [in whole cluster]
37722..38933 [in contig]
TypeCDS
Length1,212 bp (403 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative major facilitator superfamily transporter
Product (GenBank)PlmT3
Gene
Gene (GenBank)plmT3
EC number
Keyword
Note
Note (GenBank)
  • putative membrane protein
Reference
ACC
PmId
[12819191] Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster. (J Biol Chem. , 2003)
Family/Domain
FD
IPR011701

close this sectionSequence

selected fasta
>putative major facilitator superfamily transporter [PlmT3]
MMEKTIPARSMSRAWIGRYSLAWLGLWMAYLVPQQFAMPDQLARVDPAGRITDFGVINAV
CGIVALFTLPLFGTLCDRTRSRFGRRRLWVAGGATLFAGGLVATGLQSDWTGIGLSWLAC
SIGFCMATVGFTALVADQVPEAQRGTVSSAMFGPQTVGVVLGLFCLTAIPGDLPRYLLLA
AGVLVLAAPFVLKHRDTTTTRSDGGVGLRAFVASVRDNPAFAWTFGTRVLMNLANALATS
YQLYFITDVLRVAHPEQVLLLLTLVYLGWTLVSVYFCGVLSDRLGRRRAFVACGAIGQAL
GCAVVAIAPGMGTALAATSLFGVGVGAYLAVDQAIITAVLPAAENRARDLGIMNIGLFGP
QTLGPLLAGLVIGALGGYQVLFALAGVTSLVSCVLIYRVSSVC
selected fasta
>putative major facilitator superfamily transporter [PlmT3]
ATGATGGAAAAGACCATTCCTGCCAGGTCCATGTCCCGGGCCTGGATAGGCCGATACTCC
CTGGCATGGCTCGGGCTGTGGATGGCCTACCTGGTGCCGCAGCAGTTCGCCATGCCCGAC
CAGCTGGCCCGGGTCGACCCGGCCGGCCGGATCACCGACTTCGGCGTCATCAACGCCGTG
TGCGGCATCGTCGCCCTGTTCACGCTGCCGCTGTTCGGCACGCTGTGCGACCGGACCCGA
TCCCGGTTCGGCCGCCGGCGGCTCTGGGTCGCCGGCGGCGCGACGCTGTTCGCGGGCGGC
CTGGTCGCCACCGGCCTGCAATCCGACTGGACCGGGATCGGCCTGTCCTGGCTGGCGTGT
TCGATCGGCTTCTGCATGGCCACGGTCGGCTTCACCGCGCTGGTCGCCGACCAGGTCCCC
GAGGCCCAGCGCGGCACCGTCTCCAGCGCGATGTTCGGACCGCAGACGGTCGGCGTGGTG
CTCGGCCTGTTCTGCCTGACCGCGATCCCCGGCGACCTGCCGCGCTACCTGCTGCTCGCG
GCGGGCGTGCTCGTGCTGGCCGCGCCGTTCGTCCTCAAGCACCGCGATACCACAACGACC
CGGTCCGACGGTGGTGTCGGCCTCCGAGCGTTCGTGGCCAGCGTTCGGGACAACCCCGCC
TTCGCCTGGACCTTCGGCACCCGGGTGCTGATGAATCTGGCCAACGCGCTGGCCACCAGC
TACCAGCTGTACTTCATCACCGACGTGCTGCGGGTGGCTCACCCCGAGCAGGTGCTTCTG
CTGCTGACCCTGGTCTACCTGGGGTGGACGCTGGTCTCGGTCTACTTCTGCGGGGTGCTG
TCCGACCGGCTCGGCCGGCGCCGGGCGTTCGTGGCCTGCGGCGCGATCGGCCAGGCGCTG
GGCTGCGCGGTCGTCGCGATCGCGCCGGGCATGGGCACCGCGCTGGCGGCGACGTCACTG
TTCGGTGTCGGCGTCGGCGCCTACCTGGCCGTCGACCAGGCGATCATCACCGCGGTGCTG
CCGGCGGCCGAGAACCGCGCCCGGGACCTGGGCATCATGAACATCGGCCTGTTCGGACCG
CAGACCCTGGGGCCGCTGCTGGCCGGCCTGGTCATCGGCGCGCTGGGCGGATACCAGGTC
CTGTTCGCACTGGCCGGGGTCACCAGCCTCGTCAGCTGCGTGCTGATCTACCGCGTGTCC
TCGGTATGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011701 Major facilitator superfamily (Family)
 [237-397]  6.1e-18 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [2-399]  1.90000694315261e-39 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [182-403]  PS50850
PS50850   MFS
SignalP
 [1-37]  0.879 Signal
Eukaryota   
TMHMM
 [20-39]  Transmembrane (i-o) [54-76]  Transmembrane (o-i) [88-107]  Transmembrane (i-o) [113-135]  Transmembrane (o-i) [147-169]  Transmembrane (i-o) [173-192]  Transmembrane (o-i) [221-243]  Transmembrane (i-o) [258-280]  Transmembrane (o-i) [289-311]  Transmembrane (i-o) [321-343]  Transmembrane (o-i) [350-372]  Transmembrane (i-o) [377-399]  Transmembrane (o-i)
Transmembrane 12