close all open/close all

CDS information : Phosl_00160


close this sectionLocation

Organism
StrainHK803
Entry namePhoslactomycin
Contig
Start / Stop / Direction39,200 / 39,847 / + [in whole cluster]
39,200 / 39,847 / + [in contig]
Location39200..39847 [in whole cluster]
39200..39847 [in contig]
TypeCDS
Length648 bp (215 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)PlmT2
Gene
Gene (GenBank)plmT2
EC number
Keyword
Note
Note (GenBank)
  • hypothetical protein
Reference
ACC
PmId
[12819191] Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster. (J Biol Chem. , 2003)

close this sectionSequence

selected fasta
>hypothetical protein [PlmT2]
MRVVVLGVTTGLGGRLASSLLAGGDTPVGLVLRDSDGERMRAARIEPFVLDTDGSDLDVQ
LKRAFRGTDAVVLAAGTGTGPGSLGAAVSSPAAQLCAAVEDCGVRRFVMVSAHLPGARDR
AALGDQLDAYLAEKRAAEQVVREQDLDWCVLRPGMLTDDPPLGTVRARPDGVPTAGDELS
RSDCAEAIRTVLMQGITGVWHATTGSTPIEHAFRA
selected fasta
>hypothetical protein [PlmT2]
ATGCGGGTTGTCGTTCTCGGGGTGACCACCGGTCTCGGCGGCCGGCTCGCGTCCTCCCTG
CTGGCCGGCGGGGACACGCCGGTCGGACTGGTCCTGCGGGACAGCGACGGCGAGCGCATG
CGGGCCGCCCGCATCGAACCGTTCGTGCTCGACACCGACGGATCCGACCTCGACGTGCAA
CTGAAGCGGGCCTTCCGCGGCACGGACGCCGTCGTGCTGGCGGCCGGTACCGGCACCGGC
CCGGGTTCGCTCGGCGCGGCGGTGTCCTCGCCGGCGGCTCAGTTGTGCGCCGCGGTCGAG
GACTGCGGCGTCCGCCGGTTCGTCATGGTGAGTGCGCATCTGCCCGGCGCCCGGGACCGC
GCCGCTCTCGGCGACCAGCTCGATGCCTACCTGGCCGAGAAGCGCGCCGCCGAACAGGTG
GTGCGCGAGCAGGACCTGGACTGGTGCGTGCTGCGCCCTGGCATGCTGACCGACGATCCC
CCGCTGGGGACCGTGCGGGCCCGGCCCGACGGCGTTCCGACGGCCGGCGACGAACTCTCC
CGCAGCGACTGCGCCGAGGCGATCCGTACCGTGCTGATGCAGGGAATCACGGGTGTGTGG
CACGCCACGACCGGGTCGACACCCATCGAGCACGCGTTTCGCGCTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016040 NAD(P)-binding domain (Domain)
 [1-194]  1.9e-32 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-22]  0.827 Signal
Bacteria, Gram-negative   
 [1-17]  0.937 Signal
Eukaryota   
 [1-24]  0.681 Signal
Bacteria, Gram-positive   
TMHMM No significant hit