close all open/close all

CDS information : Phosl_00170


close this sectionLocation

Organism
StrainHK803
Entry namePhoslactomycin
Contig
Start / Stop / Direction41,023 / 39,941 / - [in whole cluster]
41,023 / 39,941 / - [in contig]
Locationcomplement(39941..41023) [in whole cluster]
complement(39941..41023) [in contig]
TypeCDS
Length1,083 bp (360 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative aminotransferase
Product (GenBank)PlmT1
Gene
Gene (GenBank)plmT1
EC number2.6.1.-
Keyword
Note
Note (GenBank)
  • aminotranferase
Reference
ACC
PmId
[12819191] Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster. (J Biol Chem. , 2003)
Related Reference
ACC
Q8NTT4
PmId
[12948641] Genome-based analysis of biosynthetic aminotransferase genes of Corynebacterium glutamicum. (J Biotechnol. , 2003)
Family/Domain
FD
IPR004839

close this sectionSequence

selected fasta
>putative aminotransferase [PlmT1]
MPGPRPRPELHSIAVHAASRSGGAPTAEFTHLLAANENPYDPLPGVLDAAIAATRRFNRY
PDIGCARLIAALAHRFDLPPTRFAAGAGSVGVIQSLIQAMAAPGDEVMYAWRSFEAYPVI
TKAICGATPVAVPLTDEGYHDLDAMAERVTARTRLIFLCTPNNPTGRTVSRDELADFLAR
VPEDVLVVLDEAYAEFVSDKDAADGITVCRAYPNVAVVRTFSKAFGLAGLRIGFAIAPEA
VAAALRTMATYGVSQIGQEAAIASLAASDDVMKRVDLVIAERHRMEDALIEQGWPVSCSQ
ANFLWLPLRGRSAEFAGVCARAGIGVRVLAEDGVRVTVGARESNDLFLAAAANFRLEHDQ
selected fasta
>putative aminotransferase [PlmT1]
ATGCCAGGACCACGGCCGCGTCCAGAACTGCACTCCATTGCCGTGCACGCGGCGAGCCGG
TCGGGCGGCGCGCCCACTGCGGAATTCACGCACCTGCTGGCGGCGAACGAGAACCCCTAC
GATCCGCTGCCCGGCGTCCTGGACGCGGCGATCGCGGCCACCAGGCGGTTCAACCGCTAC
CCGGATATCGGCTGCGCACGACTGATAGCCGCACTTGCACACAGGTTTGACCTGCCGCCC
ACCCGATTCGCAGCCGGCGCGGGATCGGTGGGCGTGATCCAGTCGCTCATCCAGGCGATG
GCCGCCCCAGGGGACGAAGTGATGTACGCCTGGCGGTCATTCGAGGCCTACCCCGTCATC
ACCAAGGCCATCTGCGGCGCGACCCCGGTCGCGGTTCCGTTGACCGACGAGGGGTACCAC
GACCTCGACGCCATGGCGGAGCGTGTCACCGCACGGACTCGGCTGATTTTCCTCTGCACC
CCCAACAACCCCACCGGCAGGACGGTGAGCCGCGACGAATTGGCGGATTTCCTCGCCCGC
GTTCCCGAGGACGTGCTCGTTGTCCTGGATGAGGCCTACGCCGAGTTCGTGTCCGACAAG
GACGCGGCGGACGGCATCACCGTATGCCGCGCATACCCCAATGTCGCCGTGGTGCGGACC
TTCTCCAAGGCATTCGGCCTGGCTGGATTGAGGATCGGCTTCGCCATCGCCCCGGAAGCC
GTCGCAGCAGCGCTGCGCACAATGGCGACCTATGGGGTCAGCCAGATCGGGCAGGAGGCG
GCAATCGCTTCCCTGGCCGCATCGGACGACGTTATGAAGCGGGTCGACCTGGTCATTGCC
GAGCGGCACCGGATGGAGGACGCCCTCATCGAGCAGGGCTGGCCGGTCTCATGCTCCCAG
GCCAACTTCCTCTGGCTCCCGCTCCGCGGGCGCAGTGCGGAATTCGCCGGCGTCTGTGCC
CGTGCAGGTATCGGGGTACGGGTGCTTGCCGAGGACGGGGTCCGGGTCACTGTGGGCGCC
CGGGAATCCAACGATCTCTTTCTGGCCGCGGCGGCGAATTTCCGGCTGGAGCATGACCAG
TAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001176 1-aminocyclopropane-1-carboxylate synthase (Family)
 [82-102]  8.29999581180007e-09 PR00753 [150-174]  8.29999581180007e-09 PR00753 [214-238]  8.29999581180007e-09 PR00753 [245-268]  8.29999581180007e-09 PR00753
PR00753   ACCSYNTHASE
IPR001917 Aminotransferase, class-II, pyridoxal-phosphate binding site (Binding_site)
 [220-229]  PS00599
PS00599   AA_TRANSFER_CLASS_2
IPR004839 Aminotransferase, class I/classII (Domain)
 [33-338]  1.29999999999998e-47 PF00155
PF00155   Aminotran_1_2
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [45-251]  7.4e-56 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [252-353]  6.19999999999999e-26 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [1-354]  5.29997329885557e-76 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP
 [1-17]  0.317 Signal
Bacteria, Gram-negative   
TMHMM No significant hit