close all open/close all

CDS information : Phosl_00190


close this sectionLocation

Organism
StrainHK803
Entry namePhoslactomycin
Contig
Start / Stop / Direction48,973 / 59,061 / + [in whole cluster]
48,973 / 59,061 / + [in contig]
Location48973..59061 [in whole cluster]
48973..59061 [in contig]
TypeCDS
Length10,089 bp (3,362 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)Plm2-3
Gene
Gene (GenBank)plm2-3
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase type I
Reference
ACC
PmId
[12819191] Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster. (J Biol Chem. , 2003)
[17256943] Modular polyketide synthases and cis double bond formation: establishment of activated cis-3-cyclohexylpropenoic acid as the diketide intermediate in phoslactomycin biosynthesis. (J Am Chem Soc. , 2007)

close this sectionPKS/NRPS Module

2 malonyl-CoA
3 malonyl-CoA
KS38..411
AT564..867
DH908..1075
KR1383..1563
ACP1662..1732
KS1755..2131
AT2310..2611
KR2931..3110
ACP3207..3277

close this sectionSequence

selected fasta
>polyketide synthase [Plm2-3]
MLDMTTDDSQLVAYLRKVTTDLQKTRLRLRDAETKHHEPIAIVGIGCRYPDGVHGADDLW
RLVTEGRDAISGFPQDRGWDVAGLYDPDPDAVGKSYTREGGFLSDIDLFDADFFGLSPRE
ALAMDPQQRLLLETSWEALESAGIRPATLRGSRTGVFTGVMHHDYGSRFTTAPDGFEGYV
HMGSAGSMAVGRVAYHFGLEGPAVTVDTACSSSLVSLHLACQSLRAGECDLALAGGVAIM
AGPTFFVEYSRQRVLSTDGRCHSFADDGDGTGWSEGVGVLAVERLSDARRLGHEVLAVVR
GSAVNQDGASNGMTAPSGPAQQRVIDAALRNARLSADEIDAVEAHGTGTRLGDPIEAQAL
MATYGRGRSAQRPLWLGSLKSNIGHTQAAAGVGGVIKMVQALRHGVLPRSLYAERPSTEV
DWSAGTVALLARERAWERVGDRPRRAGVSSFGMSGTNAHVVVEEFVPEPAGESAAKPSAP
WDRTSVPLVLSGRTPGAVRAQAAALREHLAARPELSLVRAARESAVHRTAFEHRAVVTGD
RDAVLAGLGEVTPVAAGGGRVAAVFSGQGAQHVGMGRQLAQDFPVFAGVLDEVCAVVDPL
LGRSLREVMWSGPAEQLERTEFAQPALFAFEVAMARQWQSWGVEFSVLAGHSVGEIAAAV
VSGALSLDDAARLAVARGRLMQRLPEGGAMLAVAAGEEEVAATLGDPALVGIAAVNGPEA
VVVSGARAEVERVAGTWRERGRRTSRLRVSHAFHSPLMEPVLDELRAVADELDRREPTLP
VSASAETTHPFATAAYWVDHARRAVRFHDAVTGLAEADVVIEIGPDTVLAPLIDSGHTVL
PSCRRERSETLTLLTALGEAHAHGVDVDWTALFPAAPRADLPPYPFQHRRYWLSPPALTG
DGTDALDHPLLSGIVELPGQGGVVLSGRIAPDRDPWLADHAVSGAVLFPGTGFLELALRA
AHQVGCRQVADLVVQTPLVLPAAGADIQVWVEPPGEPERALVIRGRSGDGDWVQYATGRL
AEEPPEPSPQGNPPADAEWAVGQWPPRGAEEMPVEELYDTLAARGYGYGPVFRGLRALWR
SGDELYAEVALPEGAHDGRYGCHPALLDAALHPLAAADDSGQQVRLPFAFGRVTVHSPGA
REVRVRLRTGTETLRLDAATSAGDPVLTLGELVLRAADTPLLTARADEHLHRLGYEVTWR
LLPDPPRADRLPGTWIVLAPPATDVSWTRDLAAHTLAVDLDATLDRPGLAARLIDVTHTA
TDPDGVLLFAAHPDILVTVLQALTDAGVDAPVWCLTHESDDALDTAAVWGAGRAAALELP
DRWGGLVDLPPAGVRPQLDCLAGLLSADTGEDHLRLRPDGVSVRRLVKPDRPVQPPADWT
PSGTVVITGGTGALGGHVARWVAGLGGCSLLLVSRRGPKAPGARELLAELAATGTPVRIV
AADVTDRSAMAELVREAAESGAPVRAVFHAAGVADETPLLETTPDRFHAVLEGKAGGARV
LDEVLGEADLDAFVVFSSVSGVWGGAGQSAYGAGNAVLDALAARRRARGLAGTALAWGPW
SGGGMVDADLERRLRRQGLTPLPVDDAVAALSTAVSLGANRVLADVAWPRFLPLFTAARP
APLFTALRPAPRRTTASTATAAAGSTAEKLAALPAADRGKALSDLVRAEIASAVGHHHMS
AVDAERPLGEFGFDSLMSVRLRNRLSAATGVRLPATLVFDHPTAGALARHLESALATEPS
PRPRQPATPGTAVADEPVAIVGMACRYPGGVASPEDLWQLVAQGRDAVTGFPTDRGWDLA
SLHHPDRSRAGTTYASEGGFLDDPAGFDADFFGISPREALAMDPQQRLLLEASWAAVEHA
GIAPGTLRGSRTGVFVGTMYNDYLSRLSSTPASLEGIIGIANSNSVMSGRISYLLGLQGP
AVTLDTACSSSLVALHLACQALRRGECDLALAGGATVMASPHIFVEFSRQGGLAADGRCK
SFSADADGTGWSEGAGLLVVERLSDARRSGHEVLAVVHGSAVNQDGSSNGLTAPSGPAQQ
RVVEAALAQAGIAAAEVDAVEAHGTGTRLGDPIEAQALIATYGRERAVERPLYLGSLKSN
IGHAQAAAGVGGVIKMVQALRHELLPRTLHAESPSPEVDWSSKAVRLLTEERPWPRGDRP
RRAGVSSFGISGTNAHIVLAEGDPLDGEPAAEAPVHGTSAESGTPVDTPDSAAARAPLPY
VLTARSAAGLPAQARALHSHLLGHPWLEPVDVARSLVTTRSLHDHRAVLVAEDRQELLDA
LAALAAPAAATPSRAVSTGTAGPGRVAGLFSGQGAQRPGMGRELARRFPVFAGVLDEVCA
VVDPLLGRSLREVMWSGPAEQLERTEFAQPALFAFEVAMARLWQSWGVEFSALAGHSVGE
IAAAYVAGVLSLPDAARMAVARGRLMQALPEGGAMVAIAAGEDEVAAGLADVPDVAIAAV
NGPEAVVVSGTEADVLRIAGHWREQGRRTSRLRVSHAFHSPLMEPMLDDFAAVLGELTFH
QPSLPVSPSADTPRPFASAEYWLDHARHAVRFADALGALDDADVLVELGPDAALSPLAGP
DKPVLPSARRDHPEVRTVVTALGSAHTHGVSVDWTAALGAGRQVRLPTYAFQHERYWLDD
DTTADRGTGSVGDPTQARFWQVVEDQDLDGLTRTLGLDAETPLRAALPVLHDWHRTSTTL
ARAAGWRYRVAWDRLPTEAPAVALDGTWWIVVPGDAADTTTADAVRQALAAAGANPRILT
VDPDGTDRAALAKELQERAAADGTVVGTVSLLAESGGEDTGHRGVAAGALATLVLLQALH
DADIPTRLWTLTRGAVRSGPADTAPDPWQAQVWGLGRVAALEHPALWGGLIDLPAEGEPA
GLAAVLSGTAGEDQVALRGDGARARRLAPADTHDAPGAGAHASGAYRWTDGAVLITGGTG
ALGAHTARMLASRGASRLVLVSRRGPAAPGAEALRAELEALGATVDLTACDVTDRDAVGR
LAEGLAAAGTPVRAVVHAAGVAAEQPLTDLVGGDFSAVTDAKVTAAEILDDVLGDDLAAF
VVYSSIAGTWGSAGNGPYAAANAHLDALVERRRARGAAGTAVAWGPWSGGGMADDRFQEE
MLRRGVRALSPEGATAALAQALEHDDTTVTVVDVDWDRFAHVFASNRPSPLLGHLTEPAA
AADEAPARTELAERLAALDAEARRGAALDLVRAEVAGVLGHATSQAVAVDRAFTDMGFDS
LMAVELRTRLGVVSGLALPTTLVFDHPSPAEVADFLCARFEPDRDALTHEILEKLDWLEN
TLLDAAHSQGARARFGSRLDALLARLDRTTAPPESRLSDPAADDIESATAEELLAFVEEH
FD
selected fasta
>polyketide synthase [Plm2-3]
GTGCTAGACATGACAACTGACGACAGCCAGCTCGTCGCATACCTGCGCAAAGTCACCACC
GATCTGCAGAAGACCCGACTGCGGCTGCGGGACGCCGAGACGAAGCACCACGAGCCGATC
GCGATCGTGGGCATCGGTTGCCGCTACCCGGACGGGGTGCACGGCGCCGATGACCTGTGG
CGGCTCGTCACGGAGGGGCGCGATGCCATCAGCGGCTTCCCGCAGGACCGCGGCTGGGAC
GTGGCCGGCCTCTACGACCCCGACCCGGACGCCGTCGGGAAGTCGTACACCCGCGAAGGC
GGCTTCCTCAGCGACATCGACCTCTTCGACGCCGACTTCTTCGGACTCAGCCCACGAGAG
GCGCTGGCCATGGACCCGCAACAGCGGCTGCTCCTGGAGACGTCCTGGGAGGCGCTGGAG
AGCGCGGGCATCCGCCCCGCCACCCTGCGCGGCAGCCGCACGGGGGTGTTCACGGGTGTC
ATGCACCACGACTACGGCAGCCGTTTCACCACGGCCCCCGACGGGTTCGAGGGCTACGTC
CACATGGGCAGCGCGGGCAGCATGGCCGTCGGCAGGGTCGCCTACCACTTCGGCCTGGAG
GGTCCCGCCGTCACCGTCGACACGGCGTGCTCGTCCTCGCTCGTCTCCCTGCACCTGGCA
TGCCAGTCGCTCCGTGCGGGCGAGTGCGATCTGGCGCTGGCCGGCGGGGTCGCGATCATG
GCCGGCCCCACCTTCTTCGTCGAGTACAGCCGTCAGCGGGTGCTGTCCACCGACGGCCGG
TGCCACTCCTTCGCCGACGACGGGGACGGAACCGGCTGGTCCGAGGGTGTGGGCGTGCTG
GCCGTGGAGCGTCTGTCGGACGCGCGGCGGCTGGGACACGAGGTCCTGGCGGTGGTGCGG
GGCAGCGCGGTCAACCAGGACGGTGCCTCGAACGGGATGACGGCGCCGAGCGGCCCCGCC
CAGCAGCGCGTCATCGACGCGGCTCTGCGCAATGCCCGTCTGAGCGCGGACGAGATCGAT
GCGGTGGAGGCGCACGGGACGGGAACGCGGCTGGGCGACCCCATCGAGGCACAGGCCTTG
ATGGCGACGTACGGCCGGGGGCGTTCGGCACAACGGCCGCTGTGGCTCGGTTCGTTGAAG
TCCAACATCGGGCACACCCAGGCGGCCGCGGGCGTCGGTGGCGTGATCAAGATGGTGCAG
GCGCTGCGGCACGGCGTCCTTCCGCGGAGCCTGTATGCGGAGCGTCCGTCGACGGAGGTC
GACTGGTCCGCCGGGACGGTCGCGCTGCTGGCGCGGGAGCGGGCGTGGGAGCGGGTCGGG
GACCGCCCGCGGCGGGCCGGGGTGTCCTCCTTCGGGATGAGCGGCACCAACGCGCATGTG
GTCGTGGAGGAGTTCGTCCCCGAGCCCGCCGGGGAGAGTGCGGCAAAGCCCTCGGCCCCG
TGGGATCGGACCTCGGTACCGCTGGTGCTGTCGGGCAGGACGCCGGGGGCGGTGCGGGCA
CAGGCGGCGGCGCTGCGGGAGCACCTGGCGGCCCGGCCGGAGCTGTCCCTCGTGCGGGCG
GCGCGGGAGTCGGCGGTGCACCGGACGGCGTTCGAGCACCGCGCGGTGGTCACGGGTGAC
CGCGACGCCGTGCTGGCCGGGCTGGGTGAGGTCACTCCCGTGGCCGCCGGCGGCGGCCGG
GTGGCGGCTGTCTTCTCCGGCCAAGGCGCTCAGCACGTCGGGATGGGCCGTCAACTGGCG
CAGGACTTCCCGGTGTTCGCCGGGGTGCTGGACGAGGTGTGCGCGGTGGTCGATCCCCTG
TTGGGGCGGTCGCTGCGGGAGGTGATGTGGTCGGGGCCCGCCGAGCAGCTGGAGCGGACC
GAGTTCGCACAGCCCGCCCTGTTCGCTTTCGAGGTGGCGATGGCGCGCCAGTGGCAGTCC
TGGGGCGTGGAGTTCTCCGTGCTCGCGGGGCACTCCGTGGGGGAGATCGCCGCCGCGGTG
GTGTCCGGGGCACTGTCCCTGGACGACGCGGCCCGGTTGGCCGTGGCGCGCGGCCGGCTG
ATGCAGCGGTTGCCGGAGGGCGGAGCGATGCTGGCCGTCGCCGCGGGCGAGGAGGAGGTC
GCCGCGACGCTGGGCGACCCGGCGCTCGTGGGCATCGCCGCGGTCAACGGCCCGGAGGCG
GTGGTCGTCTCCGGTGCCCGTGCGGAGGTCGAGCGGGTCGCCGGGACATGGCGCGAGCGT
GGTCGGCGCACGAGCCGGCTACGGGTCAGCCACGCGTTCCACTCGCCGTTGATGGAGCCG
GTGCTGGACGAGCTGCGTGCGGTGGCGGACGAGCTGGACCGGAGGGAACCGACGCTGCCG
GTGAGCGCGTCGGCCGAGACCACGCATCCGTTCGCCACCGCGGCCTACTGGGTCGACCAC
GCCCGTCGGGCGGTGCGGTTCCACGACGCGGTCACGGGCCTCGCGGAGGCGGACGTCGTC
ATCGAGATCGGCCCCGACACGGTCCTGGCACCGCTGATCGACAGCGGTCATACGGTGCTG
CCGAGTTGCCGCCGTGAGCGGAGCGAGACCCTGACGCTGCTGACCGCGCTCGGCGAGGCC
CACGCGCACGGCGTCGACGTCGACTGGACGGCCCTCTTCCCGGCCGCTCCCCGTGCCGAC
CTGCCCCCCTACCCCTTCCAGCACCGGCGCTACTGGCTCTCGCCCCCCGCCCTGACGGGT
GACGGTACCGACGCGCTGGACCACCCCCTGCTGTCCGGCATCGTGGAACTGCCGGGCCAG
GGCGGCGTGGTGCTCAGCGGCAGGATCGCGCCCGACCGGGACCCCTGGCTCGCCGACCAC
GCGGTCTCCGGTGCCGTGCTCTTCCCCGGCACCGGCTTCCTGGAACTCGCCCTGCGGGCA
GCCCATCAGGTGGGATGCCGCCAGGTCGCCGACCTCGTCGTCCAGACCCCGCTCGTGCTG
CCCGCCGCGGGCGCCGACATCCAGGTCTGGGTCGAACCGCCGGGAGAGCCGGAGCGCGCG
CTGGTCATCCGGGGCCGGAGCGGCGACGGCGACTGGGTGCAGTACGCCACGGGACGGCTC
GCGGAAGAGCCCCCCGAGCCCTCCCCTCAGGGGAATCCTCCCGCCGACGCCGAGTGGGCG
GTGGGCCAGTGGCCGCCGCGGGGCGCCGAGGAGATGCCGGTCGAGGAGCTCTACGACACC
CTCGCCGCCCGTGGCTACGGCTACGGCCCGGTCTTCCGCGGCCTGCGGGCGCTGTGGCGC
TCCGGCGACGAGCTGTACGCCGAGGTCGCCCTCCCCGAGGGGGCCCACGACGGCCGCTAC
GGCTGCCATCCCGCGCTGTTGGACGCCGCCCTGCACCCGCTGGCAGCCGCCGACGACTCC
GGTCAGCAGGTCCGGCTGCCGTTCGCCTTCGGCCGGGTCACCGTGCACTCCCCCGGCGCC
CGCGAAGTGCGCGTACGTCTGAGGACCGGCACCGAGACCCTTCGCCTGGACGCGGCCACC
AGCGCCGGGGACCCGGTTCTCACTCTCGGGGAACTGGTGCTGCGGGCGGCCGACACCCCC
CTGCTGACGGCACGGGCGGACGAACACCTCCACCGCCTCGGTTACGAGGTCACCTGGCGG
CTGCTGCCCGACCCGCCGCGCGCCGACCGGCTCCCCGGCACCTGGATCGTCCTCGCGCCA
CCGGCGACGGACGTCTCCTGGACCCGCGACCTGGCCGCGCACACGCTCGCCGTCGACCTC
GACGCCACCTTGGACCGCCCCGGCCTCGCAGCACGGCTGATCGACGTCACCCACACCGCC
ACCGACCCGGACGGTGTGCTGCTCTTCGCCGCCCACCCGGACATCCTCGTCACCGTGCTG
CAGGCGCTCACCGACGCCGGTGTGGACGCCCCGGTGTGGTGCCTGACCCATGAGTCCGAC
GACGCGCTCGACACGGCCGCCGTGTGGGGCGCGGGCCGGGCGGCAGCCCTGGAACTCCCG
GACCGCTGGGGCGGCCTGGTCGATCTGCCCCCGGCCGGTGTACGGCCCCAGCTCGACTGC
CTGGCCGGGCTGCTCTCCGCGGACACCGGCGAGGACCACCTTCGCCTGCGGCCCGACGGG
GTGTCCGTACGCCGCCTGGTCAAGCCGGACCGGCCGGTCCAACCGCCCGCCGACTGGACG
CCGTCCGGCACCGTGGTGATCACCGGGGGCACCGGTGCGCTGGGCGGTCATGTCGCGCGC
TGGGTCGCGGGGCTGGGCGGCTGCTCCCTCCTGCTCGTCTCCCGCCGGGGTCCGAAGGCG
CCCGGCGCGCGGGAACTGCTGGCCGAGCTGGCCGCCACCGGCACTCCGGTACGGATCGTC
GCCGCCGATGTCACCGACCGGTCCGCCATGGCCGAGCTGGTGCGCGAGGCGGCGGAGTCG
GGCGCCCCCGTCCGCGCGGTGTTCCACGCGGCGGGCGTCGCCGACGAGACACCGCTGCTG
GAGACCACCCCCGACCGGTTCCACGCCGTCCTGGAAGGCAAGGCGGGCGGTGCCCGGGTC
CTCGACGAGGTGCTCGGCGAAGCCGACTTGGACGCCTTCGTCGTCTTCTCCTCCGTCTCC
GGCGTCTGGGGAGGTGCGGGGCAGAGCGCGTACGGGGCGGGCAACGCCGTGCTGGACGCG
CTGGCCGCCCGGCGCCGGGCACGCGGTCTGGCCGGCACGGCGCTCGCCTGGGGCCCCTGG
TCGGGCGGCGGCATGGTCGACGCCGACCTGGAGCGACGGCTGCGACGGCAGGGCCTCACC
CCGCTCCCGGTCGACGACGCCGTGGCGGCGCTGTCGACGGCGGTGTCCCTCGGCGCGAAC
CGGGTCCTGGCCGACGTGGCGTGGCCACGATTCCTGCCGCTGTTCACCGCCGCCCGGCCC
GCCCCGCTCTTCACGGCTCTGCGTCCCGCGCCGCGCCGCACGACGGCGTCCACCGCGACG
GCCGCGGCCGGATCGACGGCCGAGAAGCTGGCCGCCCTTCCGGCCGCGGACCGCGGCAAG
GCACTGTCCGACCTCGTACGGGCCGAGATCGCCTCGGCGGTCGGGCACCACCACATGAGC
GCGGTCGACGCGGAGCGCCCGCTGGGCGAGTTCGGTTTCGACTCCCTCATGTCCGTGCGA
CTGCGCAACCGGCTCTCGGCCGCGACCGGTGTCCGTCTGCCGGCGACACTGGTCTTCGAC
CATCCGACCGCCGGCGCGCTCGCCCGGCACCTGGAGAGCGCGCTGGCCACCGAGCCGTCG
CCACGCCCCCGGCAGCCCGCCACGCCCGGGACGGCCGTCGCCGACGAACCCGTCGCCATC
GTCGGGATGGCCTGCCGCTACCCGGGTGGCGTCGCGTCCCCCGAGGATCTGTGGCAGCTC
GTCGCGCAGGGCCGGGACGCCGTCACCGGGTTCCCCACCGACCGGGGGTGGGACCTGGCG
AGCCTCCACCACCCGGATCGCTCCCGGGCCGGTACCACCTACGCCAGCGAGGGTGGATTC
CTCGACGACCCCGCTGGGTTCGACGCGGACTTCTTCGGTATCTCGCCCCGTGAGGCGCTG
GCCATGGACCCGCAGCAGCGGCTGCTCCTGGAGGCGTCCTGGGCAGCCGTGGAGCACGCG
GGGATCGCACCCGGCACACTGCGCGGCAGCCGTACCGGTGTGTTCGTCGGCACCATGTAC
AACGACTACCTGTCGCGTCTGAGCAGCACGCCGGCGAGCCTTGAGGGGATCATCGGCATA
GCCAACAGCAACAGCGTGATGTCGGGGCGGATCTCCTACCTTCTCGGGCTGCAGGGCCCG
GCGGTCACGCTCGACACCGCCTGCTCGTCCTCTCTGGTCGCCCTGCACCTCGCCTGCCAG
GCGCTGCGCCGGGGCGAGTGTGATCTCGCGCTGGCGGGCGGAGCCACCGTGATGGCGTCA
CCGCACATCTTCGTCGAGTTCAGCCGGCAGGGCGGCCTGGCCGCGGACGGCCGGTGCAAG
TCGTTCTCCGCCGACGCGGACGGCACCGGCTGGTCGGAGGGCGCAGGCCTGCTCGTCGTG
GAACGGCTGTCCGACGCGCGCCGGTCGGGACACGAGGTCCTCGCCGTGGTCCATGGCTCC
GCCGTGAACCAGGACGGTTCGTCCAACGGCCTGACCGCCCCGAGCGGTCCCGCCCAGCAG
CGTGTCGTGGAGGCCGCGCTGGCGCAGGCGGGTATCGCGGCCGCCGAGGTCGACGCCGTC
GAGGCGCACGGCACCGGCACCCGGCTGGGCGACCCGATCGAGGCCCAGGCCCTGATCGCG
ACCTACGGCCGGGAGCGCGCGGTGGAGCGGCCGCTGTACCTCGGGTCGCTGAAGTCGAAC
ATCGGCCACGCACAGGCGGCGGCCGGGGTCGGCGGTGTGATCAAGATGGTGCAGGCGCTG
CGGCACGAACTGCTGCCCCGCACGCTGCACGCCGAATCGCCGTCACCCGAGGTGGACTGG
TCGTCGAAGGCCGTGCGGCTCCTCACCGAGGAACGCCCCTGGCCCCGGGGCGACCGGCCG
CGCCGGGCCGGCGTGTCGTCGTTCGGTATCAGCGGCACGAACGCGCACATCGTGCTGGCC
GAGGGCGATCCCCTCGACGGCGAGCCCGCCGCGGAAGCACCTGTGCACGGCACGTCCGCG
GAGAGCGGCACTCCCGTGGACACGCCGGACTCCGCCGCGGCCCGGGCCCCGCTGCCGTAC
GTGCTCACCGCCCGCAGCGCGGCCGGACTCCCGGCACAGGCTCGCGCCCTGCACTCCCAC
CTGCTCGGCCACCCGTGGCTCGAACCGGTCGATGTGGCCCGGTCGTTGGTCACCACCCGA
TCGCTTCACGACCATCGGGCGGTCCTGGTGGCCGAGGACCGGCAGGAGCTGCTCGACGCG
CTCGCCGCACTCGCGGCCCCGGCCGCGGCGACGCCGAGCCGGGCGGTATCCACGGGAACG
GCCGGCCCCGGACGGGTGGCGGGCCTGTTCTCCGGTCAGGGTGCGCAGCGGCCGGGGATG
GGGCGTGAGTTGGCGAGGCGTTTCCCGGTGTTCGCCGGGGTGCTGGACGAGGTGTGCGCG
GTGGTCGACCCGTTGTTGGGGCGGTCGTTGCGGGAGGTGATGTGGTCGGGGCCCGCCGAG
CAGCTGGAGCGGACGGAGTTCGCGCAGCCGGCGTTGTTCGCGTTCGAGGTGGCGATGGCC
CGGCTGTGGCAGTCGTGGGGCGTGGAGTTCTCCGCGCTGGCGGGGCATTCGGTGGGAGAG
ATCGCCGCCGCGTATGTGGCAGGGGTCCTGTCGTTGCCGGACGCGGCACGGATGGCGGTG
GCACGGGGCCGGTTGATGCAGGCACTGCCGGAGGGCGGGGCCATGGTCGCGATCGCCGCA
GGTGAGGATGAGGTGGCCGCCGGCCTCGCGGACGTACCCGACGTGGCGATCGCCGCCGTC
AACGGCCCCGAAGCCGTCGTCGTCTCCGGGACGGAGGCCGATGTACTGCGGATCGCCGGC
CACTGGCGTGAACAGGGCCGCCGTACCTCCCGGCTGAGGGTGAGCCACGCCTTCCACTCA
CCGCTCATGGAGCCGATGCTCGACGACTTCGCGGCGGTCCTCGGCGAGCTGACCTTCCAC
CAGCCGTCCCTCCCCGTCAGCCCGTCGGCCGACACCCCGCGGCCCTTCGCCTCCGCGGAG
TACTGGCTCGACCACGCCCGCCACGCCGTCCGCTTCGCCGACGCCCTCGGCGCCCTGGAC
GACGCCGACGTGCTCGTCGAACTCGGCCCGGACGCCGCGCTGTCGCCCCTGGCAGGGCCG
GACAAGCCGGTCCTCCCCTCCGCGCGACGCGATCACCCCGAGGTACGCACCGTGGTCACG
GCGCTCGGCTCCGCGCACACCCACGGCGTATCCGTCGACTGGACGGCGGCGCTCGGGGCG
GGCAGGCAGGTCAGGCTCCCCACTTACGCCTTCCAGCACGAGCGCTACTGGCTGGACGAC
GACACCACGGCGGACCGGGGCACCGGCTCCGTGGGCGACCCGACGCAGGCACGCTTCTGG
CAGGTGGTCGAGGACCAGGACCTCGACGGCCTGACCCGCACCCTCGGTCTCGACGCGGAG
ACGCCCCTGCGGGCCGCGCTGCCGGTGCTGCACGACTGGCACCGCACCAGCACCACGCTC
GCCCGGGCCGCCGGCTGGCGCTACCGCGTCGCCTGGGACCGGTTGCCCACGGAGGCCCCG
GCCGTCGCGCTCGACGGCACCTGGTGGATCGTCGTCCCGGGGGATGCAGCCGACACCACG
ACGGCCGACGCCGTGCGGCAGGCACTCGCGGCCGCAGGTGCGAACCCCCGTATCCTCACC
GTCGACCCGGACGGGACGGACCGCGCGGCGCTGGCCAAGGAACTCCAGGAACGTGCCGCG
GCCGACGGCACGGTGGTGGGGACGGTGTCCCTGCTGGCGGAGTCCGGCGGCGAGGACACC
GGGCACCGCGGCGTCGCGGCCGGGGCCCTGGCCACCCTGGTGCTCCTGCAGGCTCTGCAC
GACGCGGACATCCCGACCCGTCTGTGGACGCTGACGCGGGGCGCGGTACGCAGCGGCCCG
GCGGACACCGCACCGGACCCCTGGCAGGCCCAGGTCTGGGGCCTGGGTCGCGTCGCCGCC
CTCGAACACCCGGCGTTGTGGGGCGGTCTGATCGATCTCCCCGCCGAAGGGGAGCCGGCC
GGCTTGGCCGCCGTCCTTTCCGGGACCGCCGGGGAGGACCAGGTGGCGCTGCGCGGGGAC
GGCGCACGCGCACGTCGCCTCGCCCCTGCCGACACGCACGACGCCCCGGGGGCCGGCGCC
CATGCATCCGGTGCGTACCGGTGGACGGACGGGGCGGTACTGATCACCGGCGGTACCGGA
GCACTCGGTGCGCACACCGCCCGCATGCTCGCCTCGCGGGGGGCGTCCCGGCTGGTCCTC
GTCAGCCGTCGCGGTCCCGCCGCTCCCGGCGCCGAGGCGCTGCGCGCCGAACTGGAGGCG
CTCGGCGCGACGGTCGACCTGACGGCCTGTGACGTGACCGACCGCGACGCCGTCGGCCGG
CTGGCCGAGGGCCTCGCCGCCGCCGGCACCCCCGTCCGCGCGGTGGTGCACGCGGCGGGT
GTCGCCGCCGAGCAGCCGTTGACGGACCTCGTCGGGGGCGACTTCTCGGCGGTGACCGAC
GCGAAGGTCACCGCCGCGGAGATCCTCGACGACGTGCTGGGGGACGACCTGGCGGCATTC
GTCGTCTACTCCTCCATCGCCGGCACCTGGGGCAGCGCGGGCAACGGCCCGTACGCCGCC
GCCAACGCCCACCTGGACGCACTGGTCGAGCGGCGTCGGGCCCGCGGCGCCGCCGGCACG
GCCGTCGCCTGGGGCCCCTGGAGCGGGGGCGGCATGGCGGACGACCGCTTCCAGGAGGAG
ATGCTGCGCCGCGGAGTCCGCGCCCTCTCCCCCGAAGGTGCCACCGCCGCCCTCGCTCAG
GCCCTGGAGCACGACGACACCACGGTCACGGTCGTCGATGTCGACTGGGACCGCTTCGCC
CACGTCTTCGCCAGCAACCGCCCCAGCCCGCTGCTCGGGCACCTGACGGAGCCCGCCGCC
GCTGCCGATGAGGCGCCCGCCCGGACGGAACTGGCCGAGCGTCTGGCGGCCCTGGATGCC
GAGGCGCGGCGCGGCGCGGCGCTGGATCTGGTGCGCGCGGAGGTCGCGGGGGTGCTGGGG
CATGCCACGTCGCAGGCCGTCGCCGTGGACCGCGCCTTCACCGACATGGGGTTCGACTCC
CTCATGGCAGTCGAACTGCGCACCCGGCTCGGCGTGGTCAGCGGCCTCGCGCTGCCGACC
ACCCTCGTCTTCGACCACCCGAGTCCCGCTGAGGTCGCCGACTTCCTCTGCGCACGGTTC
GAACCCGATCGCGACGCCCTCACCCACGAGATCCTGGAGAAGCTCGACTGGCTGGAGAAC
ACCCTGCTGGACGCCGCGCACAGCCAGGGCGCCCGCGCACGGTTCGGCTCCCGGCTCGAT
GCCCTGCTCGCCCGACTCGACCGTACGACGGCCCCGCCCGAGAGCCGGCTGTCGGACCCG
GCCGCGGACGACATCGAATCGGCGACCGCCGAAGAACTGCTCGCATTCGTCGAGGAGCAT
TTCGACTAG
[2] KS38..411
[2] AT564..867
[2] malonyl-CoA751..755
[2] DH908..1075
[2] KR1383..1563
[2] ACP1662..1732
[3] KS1755..2131
[3] AT2310..2611
[3] malonyl-CoA2496..2500
[3] KR2931..3110
[3] ACP3207..3277
[2] KS112..1233
[2] AT1690..2601
[2] malonyl-CoA2251..2265
[2] DH2722..3225
[2] KR4147..4689
[2] ACP4984..5196
[3] KS5263..6393
[3] AT6928..7833
[3] malonyl-CoA7486..7500
[3] KR8791..9330
[3] ACP9619..9831

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [555-684]  G3DSA:3.40.366.10 [751-856]  G3DSA:3.40.366.10 [2298-2429]  G3DSA:3.40.366.10 [2496-2601]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1690-1705]  PS00012 [3235-3250]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1666-1731]  1.4e-10 PF00550 [3210-3276]  2.1e-10 PF00550
PF00550   PP-binding
 [1662-1732]  PS50075 [3207-3277]  PS50075
PS50075   ACP_DOMAIN
 [1655-1772]  3.80000697093586e-25 SSF47336 [3198-3284]  2.30000440726534e-20 SSF47336
SSF47336   ACP_like
 [1661-1735]  4.10000000000004e-40 G3DSA:1.10.1200.10 [3206-3279]  4.10000000000004e-40 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1383-1562]  4.80000000000003e-59 PF08659 [2931-3109]  1.2e-54 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [38-288]  1.20000000000001e-95 PF00109 [1755-2006]  3.19999999999996e-96 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [296-411]  1.29999999999998e-44 PF02801 [2014-2131]  1.09999999999999e-43 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [564-867]  5.50000000000008e-65 PF00698 [2310-2611]  2.59999999999998e-61 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [6-31]  4.5e-06 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [560-850]  6.89998448199219e-63 SSF52151 [2305-2578]  9.30000048475975e-63 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [686-750]  1.89999859865864e-16 SSF55048 [2431-2495]  1.59999889349252e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [40-300]  G3DSA:3.40.47.10 [301-465]  1.79999999999997e-121 G3DSA:3.40.47.10 [1758-2018]  G3DSA:3.40.47.10 [2019-2181]  1.79999999999997e-121 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [30-468]  7.29994178862692e-103 SSF53901 [1755-2130]  8.29994113369276e-102 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1383-1569]  1e-68 G3DSA:3.40.50.720 [2930-3151]  4.80000000000003e-65 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [201-217]  PS00606 [1919-1935]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [564-847]  2.7000136937899e-106 SM00827 [2309-2592]  3.39999972437719e-108 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1663-1735]  9.10000425645573e-30 SM00823 [3208-3280]  1.29999924468179e-31 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [908-1075]  3.10001307370203e-67 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [40-467]  SM00825 [1758-2184]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1383-1563]  5.09998762524166e-53 SM00822 [2931-3110]  1.20000117458134e-42 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit