close all open/close all

CDS information : Phosl_00200


close this sectionLocation

Organism
StrainHK803
Entry namePhoslactomycin
Contig
Start / Stop / Direction59,191 / 62,202 / + [in whole cluster]
59,191 / 62,202 / + [in contig]
Location59191..62202 [in whole cluster]
59191..62202 [in contig]
TypeCDS
Length3,012 bp (1,003 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative 3-phosphoshikimate 1-carboxyvinyltransferase/putative carboxylic acid--CoA ligase
Product (GenBank)PlmJK
Gene
Gene (GenBank)plmJK
EC number
Keyword
  • CHC
Note
  • bifunctional protein
Note (GenBank)
Reference
ACC
PmId
[12819191] Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster. (J Biol Chem. , 2003)
Related Reference
ACC
P0A6D3
PmId
[1899181] 5-Enolpyruvylshikimate-3-phosphate synthase from Escherichia coli--the substrate analogue bromopyruvate inactivates the enzyme by modifying Cys-408 and Lys-411. (Arch Biochem Biophys. , 1991)
ACC
O07454
PmId
[9177244] A cluster of bacterial genes for anaerobic benzene ring biodegradation. (Proc Natl Acad Sci U S A. , 1997)
ACC
P38135
PmId
[12535077] A new Escherichia coli metabolic competency: growth on fatty acids by a novel anaerobic beta-oxidation pathway. (Mol Microbiol. , 2003)
[15213221] The Escherichia coli fadK (ydiD) gene encodes an anerobically regulated short chain acyl-CoA synthetase. (J Biol Chem. , 2004)
Family/Domain
FD
IPR006264

close this sectionSequence

selected fasta
>putative 3-phosphoshikimate 1-carboxyvinyltransferase/putative carboxylic acid--CoA ligase [PlmJK]
MHLLVKGIQHRISSEILVPNSKYHAHRALILASLADGESRIHGLSDARHVEYTVRLLRGL
GVQLVREGDTFVVRGLGGHYRPVQDTVSAGSSGTTLYFMTGLASLSNRAVTITGQKYFRN
RPVGPLLRALEQIGVRLESANDCPPVQVRSHRPTGGEVTIPGTLSQWISGLLLLAPFATG
PTTITVSDTLNERTYLELTVAMMRQFGLEVTVAPDWRRFDVAPHQSVRPTELTLPPDIGS
AAFGIATAALHPSDVLLRGMPSLTGGPADHPEFHFLDIARSMGVPMELDPVAGGVRIQQD
APLLKAVDVDCRDVPDMLPVLSTLATFAHGESVFRNVAHTRLKESDRAGVMVQLNSMGAE
LELSDDTLRVTGVDSLVGAELSSYNDHRVLMSLAVASSRARGHSTLSYPHAYRISYPGFL
DMMNSVGVPTSVEKGPARSARSRARRPVREPVRSVADPDHACEVTLPEWLARHAASRPGD
TALVDVRPDGDSVVTWSDLAGRVDKAAALLLELGVRPGENVAYQLPNRLEFVVLSLAALR
IGAVCCPVIPFFRERELGFVLRRSLARVLVVMDEYRSRRPAQEALALAATGGPDTAHLEH
VVVLARSGGGSRPPQPPPGGVRLHDWESALRTTTVDRAALDAIRPTPGATAQLLFTSGTT
GEPKGVMQSSSNLVRAVSMEIRHLGLGPEDAVWVPSPLAHQTGFLYGMTLATVLGVPQIL
QSDWDARRALVSLNTHRATFVQAATPFLADLVKAVEEIGEAPRHLRLFVATGATVPRSLA
EHASEVLGTMVCGAFGTTETCLGALSRPTDTPERRWGTDGRVLDGVRLRVTDDRGAVLAP
GAEGNFEILSRTTFEGYLDRPDLTAEAFTPDGWFRTGDLAVLDESGYVRITGRVKDVINR
GGEKIPVGEMEQLLFRHPAVDDVAIVAMPDERLGERACAFVVLKDGALLGFEEMCRYLDG
HQAAKQYWPERLQLVPDLPRNPIGKVQKFELRARARHLRPHMQ
selected fasta
>putative 3-phosphoshikimate 1-carboxyvinyltransferase/putative carboxylic acid--CoA ligase [PlmJK]
ATGCATCTTCTCGTCAAGGGAATTCAGCACCGGATTTCCAGCGAAATCCTCGTACCGAAC
TCCAAATATCATGCACACCGCGCGCTGATCCTCGCCTCGCTCGCGGACGGGGAGAGCCGG
ATCCACGGCCTGTCCGACGCCCGGCACGTCGAGTACACCGTGCGGCTGCTGCGCGGCCTC
GGCGTACAGCTCGTCCGCGAGGGCGACACCTTCGTGGTGCGGGGGCTCGGCGGCCACTAC
CGGCCGGTCCAGGACACCGTCTCGGCCGGCAGCTCCGGCACCACCCTCTATTTCATGACC
GGGCTCGCGTCCCTGTCGAACCGCGCGGTCACGATCACCGGGCAGAAATACTTCCGTAAC
CGCCCCGTGGGCCCGCTGCTGCGCGCGCTGGAACAGATAGGTGTACGCCTGGAGTCGGCG
AATGACTGCCCGCCCGTCCAGGTCCGCAGCCATCGACCCACGGGCGGCGAGGTGACCATT
CCGGGCACCTTGTCCCAGTGGATATCCGGACTGCTGCTGCTCGCGCCGTTCGCCACCGGC
CCCACCACCATCACCGTGTCGGACACCCTCAACGAACGCACCTATCTGGAGCTGACCGTC
GCGATGATGCGGCAGTTCGGCCTGGAAGTGACCGTGGCGCCCGACTGGCGGCGCTTTGAC
GTGGCGCCGCATCAGAGCGTGCGGCCCACCGAGCTGACGTTGCCCCCCGACATCGGTTCC
GCGGCCTTCGGCATCGCCACCGCCGCGCTCCACCCCTCCGACGTGCTCCTGCGCGGTATG
CCGAGCCTGACCGGGGGGCCGGCCGACCACCCCGAGTTCCACTTCCTCGACATCGCACGC
TCGATGGGCGTCCCCATGGAACTGGACCCGGTGGCCGGCGGTGTCCGGATCCAGCAGGAC
GCCCCCCTGCTGAAGGCCGTCGATGTCGACTGCCGCGACGTGCCGGACATGCTTCCCGTC
CTTTCCACCCTCGCCACCTTCGCGCACGGCGAGTCGGTGTTCCGCAACGTCGCGCACACG
CGGCTGAAGGAGTCCGACCGGGCCGGCGTGATGGTCCAGCTCAACTCCATGGGCGCCGAG
CTGGAGTTGTCCGACGACACCCTGCGGGTGACCGGGGTGGACTCTCTGGTCGGCGCGGAG
CTGTCCTCGTACAACGACCACCGGGTGCTGATGTCGCTGGCCGTCGCCTCCTCGCGCGCC
CGGGGCCACTCCACGCTGTCGTACCCGCACGCCTACCGCATCTCGTATCCGGGCTTCCTC
GACATGATGAACAGCGTCGGCGTGCCGACCTCCGTGGAGAAGGGCCCCGCACGCTCCGCC
AGGAGCCGTGCCCGCCGGCCCGTCCGGGAACCCGTGCGGTCTGTCGCGGATCCGGACCAC
GCCTGCGAGGTCACCCTGCCGGAGTGGCTGGCCCGGCACGCCGCGTCCCGCCCCGGTGAC
ACCGCCCTCGTGGACGTGCGCCCGGACGGCGACTCCGTCGTCACCTGGAGCGACCTGGCC
GGCCGGGTGGACAAGGCCGCCGCGCTGCTGCTCGAACTCGGTGTGCGGCCGGGCGAGAAC
GTGGCGTACCAGCTGCCCAACCGCCTGGAGTTCGTGGTGCTGTCGCTGGCGGCGCTGCGG
ATCGGCGCCGTCTGCTGCCCGGTCATCCCGTTCTTCCGGGAACGCGAACTCGGCTTCGTC
CTGCGCCGCTCGCTGGCCCGCGTCCTGGTCGTCATGGACGAGTACCGGTCCCGGCGCCCC
GCGCAGGAGGCACTTGCCCTCGCCGCCACCGGTGGCCCGGACACGGCGCACCTGGAGCAT
GTCGTGGTGCTGGCCCGGTCGGGCGGCGGCAGCCGACCGCCACAGCCGCCCCCGGGCGGC
GTCCGCCTGCACGACTGGGAGAGCGCCCTGCGGACGACGACGGTCGACCGGGCGGCCCTC
GACGCGATCCGGCCGACGCCCGGGGCGACGGCGCAGCTGCTGTTCACCTCGGGCACCACC
GGCGAGCCCAAGGGGGTCATGCAGTCGTCCTCGAACCTGGTCCGGGCCGTGTCGATGGAG
ATCCGGCATCTCGGCCTCGGTCCCGAGGACGCCGTCTGGGTGCCCTCTCCGCTCGCCCAC
CAGACCGGGTTCCTGTACGGGATGACGCTGGCGACCGTGCTGGGTGTGCCCCAGATCCTG
CAGTCCGACTGGGACGCGCGGCGCGCCCTGGTCTCGCTGAACACGCACCGGGCGACGTTC
GTCCAGGCCGCCACGCCGTTCCTGGCCGATCTGGTGAAGGCGGTCGAGGAGATCGGCGAG
GCGCCCCGGCATCTGCGGCTCTTCGTGGCCACCGGCGCCACCGTGCCCCGCTCGCTGGCC
GAGCACGCGAGCGAGGTGTTGGGCACGATGGTGTGCGGCGCGTTCGGCACCACCGAAACC
TGCCTCGGCGCGCTGTCGAGGCCGACCGACACACCGGAGCGGCGCTGGGGCACCGACGGG
CGCGTCCTGGACGGCGTACGGCTGCGGGTCACCGACGATCGGGGCGCGGTGCTGGCGCCG
GGCGCCGAGGGCAACTTCGAGATCCTCTCGCGGACGACCTTCGAGGGCTATCTCGACCGC
CCCGACCTGACCGCGGAGGCCTTCACCCCGGACGGCTGGTTCCGCACCGGCGACCTCGCG
GTGCTCGACGAGTCGGGCTACGTCCGTATCACCGGCCGGGTCAAGGACGTGATCAACCGC
GGCGGCGAGAAGATCCCCGTCGGCGAGATGGAGCAGCTGCTGTTCCGCCACCCCGCCGTC
GACGACGTGGCCATCGTGGCCATGCCCGACGAGCGTCTCGGCGAGCGTGCCTGCGCGTTC
GTGGTGCTCAAGGATGGCGCGCTGCTCGGCTTCGAGGAGATGTGCCGCTACCTGGACGGG
CACCAGGCAGCCAAGCAGTACTGGCCGGAACGGCTCCAGCTCGTCCCGGATCTCCCGCGC
AACCCGATCGGCAAGGTCCAGAAGTTCGAACTGCGAGCCAGGGCGCGCCACCTGCGGCCC
CACATGCAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [495-924]  1.79999999999997e-87 PF00501
PF00501   AMP-binding
IPR001986 Enolpyruvate transferase domain (Domain)
 [9-422]  4.49999999999996e-81 PF00275
PF00275   EPSP_synthase
 [25-233]  5.50000000000008e-77 G3DSA:3.65.10.10 [234-428]  1.29999999999998e-83 G3DSA:3.65.10.10
G3DSA:3.65.10.10   EPSP_synthase
IPR006264 3-phosphoshikimate 1-carboxyvinyltransferase (Family)
 [15-427]  4.59999999999996e-92 TIGR01356
TIGR01356   AroA
IPR013792 RNA 3'-terminal phosphate cyclase/enolpyruvate transferase, alpha/beta (Domain)
 [1-430]  8.10000734323267e-96 SSF55205
SSF55205   RNA3'_cycl/enolpyr_transf_A/B
IPR020845 AMP-binding, conserved site (Conserved_site)
 [653-664]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit