close all open/close all

CDS information : Phosl_00210


close this sectionLocation

Organism
StrainHK803
Entry namePhoslactomycin
Contig
Start / Stop / Direction62,226 / 63,392 / + [in whole cluster]
62,226 / 63,392 / + [in contig]
Location62226..63392 [in whole cluster]
62226..63392 [in contig]
TypeCDS
Length1,167 bp (388 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative acyl-CoA dehydrogenase
Product (GenBank)PlmL
Gene
Gene (GenBank)plmL
EC number1.3.99.-
Keyword
  • CHC
Note
Note (GenBank)
Reference
ACC
PmId
[12819191] Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster. (J Biol Chem. , 2003)
Related Reference
ACC
Q937T2
PmId
[11571189] Cloning and genetic characterization of dca genes required for beta-oxidation of straight-chain dicarboxylic acids in Acinetobacter sp. strain ADP1. (Appl Environ Microbiol. , 2001)

close this sectionSequence

selected fasta
>putative acyl-CoA dehydrogenase [PlmL]
MMDEQRFGQVRDMVERWVEGPGERWAERIEETGEVPEAVWSELDELGFLRLAAPVEYGGQ
GLGFTQWMELMEIFSRSHGSLRMIVHVVNGIWRSMDGHACDEQRKRFVVPSVLGEIKIAF
ALTEPGNGTGADITTSVVREGDTYYLSGRKHLITFGMRCDYYLLAARVAGSAGHEGTVAL
LVPRNAPGVSAEDTSRTMGVTGTDHASIVFDRTPVPVDHRLGEEGQGLEVFLGGFLTPSR
ISVAMSCVGLAQRAQQLAVDYARSRVTFGKSLTERQAIQFMLAENAADIEAARQLVLHAA
RRFEEGADDASMQSSMAKMHAVTMLTTVTDKALQVHGGLGYWKSQKIERVYRDARAQRFE
EGPNEVQKAVVFRELLRQAGTVTAGGAR
selected fasta
>putative acyl-CoA dehydrogenase [PlmL]
ATGATGGACGAGCAGCGGTTCGGACAAGTCCGTGACATGGTCGAGCGGTGGGTGGAGGGC
CCGGGCGAGCGCTGGGCCGAACGCATCGAGGAGACCGGCGAGGTGCCCGAGGCGGTGTGG
AGCGAGCTCGACGAGCTCGGGTTCCTGCGGCTCGCCGCCCCGGTGGAGTACGGCGGCCAG
GGCCTCGGGTTCACCCAGTGGATGGAGCTGATGGAGATCTTCTCCCGCTCCCACGGTTCC
CTGCGCATGATCGTGCACGTCGTCAACGGCATCTGGCGGTCGATGGACGGTCACGCCTGC
GACGAACAGCGCAAGCGGTTCGTGGTGCCGTCCGTCCTGGGCGAGATCAAGATCGCGTTC
GCGCTGACCGAGCCGGGCAACGGCACCGGGGCGGACATCACGACCTCGGTGGTCCGCGAG
GGCGACACCTACTACCTGTCGGGCCGCAAGCACCTGATCACGTTCGGGATGCGCTGTGAC
TACTACCTCCTGGCGGCGCGCGTCGCGGGCTCCGCGGGCCACGAGGGCACCGTCGCCCTG
CTCGTGCCGCGCAACGCGCCCGGAGTGAGCGCCGAGGACACCTCCCGCACGATGGGCGTC
ACCGGCACCGACCACGCCTCGATCGTCTTCGACCGCACCCCCGTGCCCGTGGACCACCGG
CTCGGCGAGGAGGGCCAGGGGCTGGAGGTGTTCCTCGGGGGGTTCCTCACCCCGTCGCGG
ATCTCCGTCGCGATGAGCTGCGTCGGCCTCGCCCAGCGCGCCCAGCAGCTCGCCGTCGAC
TACGCCCGCTCCCGGGTGACCTTCGGCAAGTCGCTGACGGAGCGTCAGGCCATTCAGTTC
ATGCTCGCCGAGAACGCGGCGGACATCGAGGCGGCCCGACAGCTCGTGCTGCACGCCGCA
CGCCGCTTCGAGGAGGGCGCCGACGACGCGTCCATGCAGTCCTCGATGGCCAAGATGCAC
GCGGTGACGATGCTGACCACCGTCACCGACAAGGCGCTGCAGGTCCACGGCGGGCTCGGC
TACTGGAAGTCCCAGAAGATCGAGCGCGTCTACCGCGACGCCCGTGCCCAGCGCTTCGAG
GAGGGCCCCAACGAGGTGCAGAAAGCCGTGGTCTTCCGCGAACTGCTGCGGCAGGCCGGG
ACCGTCACCGCGGGAGGTGCGCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006090 Acyl-CoA oxidase/dehydrogenase, type 1 (Domain)
 [225-375]  2.89999999999999e-41 PF00441
PF00441   Acyl-CoA_dh_1
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [119-213]  7.59999999999998e-25 G3DSA:2.40.110.10
G3DSA:2.40.110.10   Acyl_CoA_DH/ox_M
 [119-168]  1e-13 PF02770
PF02770   Acyl-CoA_dh_M
IPR006092 Acyl-CoA dehydrogenase, N-terminal (Domain)
 [9-112]  1.3e-14 PF02771
PF02771   Acyl-CoA_dh_N
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [214-380]  1e-55 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
 [223-378]  1.70000295590053e-46 SSF47203
SSF47203   AcylCoADH_C_like
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [9-225]  1.49999648196323e-54 SSF56645
SSF56645   AcylCoA_dehyd_NM
IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal (Domain)
 [9-109]  1.4e-20 G3DSA:1.10.540.10
G3DSA:1.10.540.10   AcylCoA_DH/ox_N
SignalP No significant hit
TMHMM No significant hit