close all open/close all

CDS information : Phosl_00220


close this sectionLocation

Organism
StrainHK803
Entry namePhoslactomycin
Contig
Start / Stop / Direction63,389 / 64,231 / + [in whole cluster]
63,389 / 64,231 / + [in contig]
Location63389..64231 [in whole cluster]
63389..64231 [in contig]
TypeCDS
Length843 bp (280 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative 1-cyclohexenylcarbonyl-CoA reductase
Product (GenBank)ChcA
Gene
Gene (GenBank)chcA
EC number
Keyword
  • CHC
Note
Note (GenBank)
Reference
ACC
PmId
[12819191] Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster. (J Biol Chem. , 2003)
[16609856] Genetic manipulation of the biosynthetic process leading to phoslactomycins, potent protein phosphatase 2A inhibitors. (J Ind Microbiol Biotechnol. , 2006)
Related Reference
ACC
P95727
PmId
[1597409] Purification and characterization of a novel enoyl coenzyme A reductase from Streptomyces collinus. (J Bacteriol. , 1992)
[8955309] Cloning and characterization of the gene encoding 1-cyclohexenylcarbonyl coenzyme A reductase from Streptomyces collinus. (J Bacteriol. , 1996)
[10973220] Identification of a cyclohexylcarbonyl CoA biosynthetic gene cluster and application in the production of doramectin. (Nat Biotechnol. , 2000)

close this sectionSequence

selected fasta
>putative 1-cyclohexenylcarbonyl-CoA reductase [ChcA]
MNDIRHDDAAGGTKISLITGASRGIGRALALTLARQGGTVFVNYKKNAELAEKTVADIEE
AGGRGIAVQADVETTEGVTALFDEVGQRYGRLDHFVSNAAASVFKNILDLGQHHLDRSYA
MNLRPFVLGAQQAVKLMDDGGRIVALSSYGSVRAYPTYAALGGMKAAIEAWVRYMAVEFA
PYGINVNAVNGGLIDSDSLAYFYGIEGMPDMRGVLDRIPAGRPGTVQEMADTVAFLLGEG
AGYLTGQTLVVDGGLSVVAPPFFADAGEALRLPPRPTRES
selected fasta
>putative 1-cyclohexenylcarbonyl-CoA reductase [ChcA]
ATGAACGACATCCGACACGACGACGCGGCCGGCGGCACCAAGATCTCCCTCATCACAGGC
GCTTCGCGCGGCATCGGACGCGCCCTCGCCCTCACCCTGGCCCGCCAGGGCGGCACCGTG
TTCGTCAACTACAAGAAGAACGCCGAACTGGCCGAGAAGACCGTCGCCGACATCGAGGAG
GCCGGCGGCCGGGGCATCGCCGTGCAGGCCGATGTCGAGACGACGGAAGGCGTCACGGCG
CTGTTCGACGAGGTCGGACAGCGCTACGGACGCCTGGACCACTTCGTCTCCAACGCCGCC
GCCAGTGTCTTCAAGAACATCCTCGACCTCGGCCAGCACCACTTGGACCGCTCCTACGCC
ATGAACCTGCGCCCCTTCGTGCTCGGCGCCCAGCAGGCGGTCAAGCTCATGGACGACGGA
GGCCGGATCGTCGCGCTGTCGTCGTACGGATCGGTCCGCGCCTACCCGACGTACGCCGCG
CTCGGCGGGATGAAGGCGGCGATCGAGGCGTGGGTGCGGTACATGGCGGTCGAGTTCGCG
CCGTACGGCATCAACGTCAACGCGGTGAACGGCGGCCTGATCGATTCCGACTCGCTCGCC
TACTTCTACGGCATCGAGGGCATGCCCGACATGCGCGGCGTCCTGGACCGCATCCCCGCC
GGGCGGCCCGGCACGGTGCAGGAGATGGCCGACACCGTCGCCTTCCTGCTGGGTGAGGGG
GCCGGCTACCTCACGGGTCAGACCCTGGTCGTCGACGGGGGCCTGAGCGTGGTCGCCCCG
CCGTTCTTCGCGGACGCCGGCGAGGCACTGCGTCTGCCGCCCCGCCCGACACGGGAATCC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [15-32]  2.10000267834031e-26 PR00081 [90-101]  2.10000267834031e-26 PR00081 [135-151]  2.10000267834031e-26 PR00081 [161-180]  2.10000267834031e-26 PR00081 [182-199]  2.10000267834031e-26 PR00081 [219-239]  2.10000267834031e-26 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [14-258]  1.69999999999998e-69 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-30]  0.28 Signal
Bacteria, Gram-negative   
TMHMM No significant hit