close all open/close all

CDS information : Phosl_00230


close this sectionLocation

Organism
StrainHK803
Entry namePhoslactomycin
Contig
Start / Stop / Direction64,251 / 66,329 / + [in whole cluster]
64,251 / 66,329 / + [in contig]
Location64251..66329 [in whole cluster]
64251..66329 [in contig]
TypeCDS
Length2,079 bp (692 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative oxidoreductase
Product (GenBank)PlmM
Gene
Gene (GenBank)plmM
EC number
Keyword
  • CHC
Note
Note (GenBank)
Reference
ACC
PmId
[12819191] Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster. (J Biol Chem. , 2003)
Related Reference
ACC
P42593
PmId
[9346310] Cloning and expression of the fadH gene and characterization of the gene product 2,4-dienoyl coenzyme A reductase from Escherichia coli. (Eur J Biochem. , 1997)

close this sectionSequence

selected fasta
>putative oxidoreductase [PlmM]
MYDHVFRAGAIGTMRLPHRIVMGAMHLNLETGDDDGAALAAFYAERAAAGAALIVTGGVA
VNAVGAGGPGYGVIGDSRDRAALSAAVRAVHEHGGRIALQLFHAGRYARPGAREGAGHPV
APSPVHSAFARCTPRVMSPRDITTTIDDFAEGARAARALGFDAVEVMGSEGYLINQFTAP
LTNLRDDAWGGDAERRRRFPLEVLHAVRAAVGRDFPVLFRISGNDLMAGGTPPDEVTALT
VALAGAGADALSVGVGWHESPVPTVQSEVPAGTWAACAKALKRTLLAAGHTDVAVIAANR
FPHLAQADEALSGGEVDFVAMARPFLADPQLVAKSAAGHPDRVNGCIACNEACIDRSFGT
ERVSCLVNPRAGHERQFPPPQPARHRSGPFGRYAVIGAGIAGLEAARTLAGLGHRVEVYE
AAARAGGQFRLASQVPGKAEFAGTIHHHVRELRDAGVPLHLGRRVGGADVPELRSFDGVV
LATGVLPAGLPLSGAELPHVRNYAQAFADPEALGGRIVIIGGGGIAIDLAHTLTTDPDAE
VTPEEFLARHAVAGSTPHSGREPAVRDAPREVTLLRRGRRIGAGIGPSTRWVVMRNLRAA
GVRMLTGVTYREITPTGVLLTDAEGTEHSLDADHVVLAVGQVPVDELAPLLREAGVPVVT
AGGAAGTDGLNAVRATAEGLRAAHRISRVAVG
selected fasta
>putative oxidoreductase [PlmM]
GTGTACGACCATGTCTTCCGGGCCGGCGCCATCGGCACCATGAGGCTTCCGCATCGCATC
GTCATGGGCGCCATGCACCTCAATCTGGAGACCGGTGACGATGACGGCGCGGCCCTGGCC
GCGTTCTACGCCGAGCGCGCGGCCGCGGGCGCGGCGCTCATCGTCACCGGAGGCGTGGCG
GTCAACGCCGTGGGCGCGGGCGGCCCGGGGTACGGGGTGATCGGCGACTCCCGGGACAGG
GCGGCCCTCTCGGCGGCGGTGCGTGCGGTGCACGAGCACGGTGGACGGATCGCTCTGCAG
CTCTTTCACGCCGGGCGGTACGCTCGGCCCGGCGCCCGCGAGGGAGCCGGGCATCCCGTC
GCCCCGTCGCCGGTGCACAGCGCCTTCGCCCGCTGCACCCCCCGGGTGATGTCCCCCCGG
GACATCACCACCACGATCGACGACTTCGCCGAGGGAGCGCGCGCCGCACGCGCCCTCGGA
TTCGATGCCGTGGAGGTGATGGGCTCCGAGGGCTATCTGATCAACCAGTTCACGGCACCG
CTGACCAACCTGCGCGACGACGCGTGGGGCGGTGACGCCGAACGGCGCCGCCGGTTTCCG
CTGGAGGTGCTGCACGCGGTCCGCGCGGCCGTGGGCCGGGACTTCCCGGTGCTCTTCCGC
ATCTCCGGGAACGACCTGATGGCCGGGGGCACTCCGCCGGACGAGGTGACCGCGCTCACG
GTGGCGCTCGCCGGGGCCGGGGCCGACGCGCTCTCCGTGGGCGTGGGCTGGCACGAGTCA
CCGGTGCCCACCGTGCAGTCCGAGGTCCCCGCCGGTACCTGGGCGGCCTGCGCCAAGGCA
CTCAAACGCACGCTGCTGGCCGCCGGCCACACGGATGTCGCGGTGATCGCCGCCAACCGC
TTCCCGCACCTCGCGCAGGCCGACGAAGCCCTGTCCGGTGGTGAGGTGGACTTCGTGGCC
ATGGCGCGGCCGTTCCTGGCCGACCCTCAGCTCGTCGCCAAGTCGGCCGCCGGCCACCCC
GACCGGGTAAATGGCTGCATCGCCTGCAACGAGGCGTGCATCGACCGCTCCTTCGGCACC
GAAAGGGTCTCCTGCCTCGTCAACCCCAGAGCCGGACACGAAAGGCAGTTCCCCCCGCCG
CAGCCGGCCCGCCACCGCAGTGGGCCGTTCGGCCGCTACGCCGTGATCGGCGCGGGCATC
GCCGGACTGGAGGCCGCCCGCACGCTGGCCGGCCTCGGCCACCGTGTCGAGGTGTACGAA
GCCGCGGCCCGCGCCGGCGGTCAGTTCCGGCTGGCCTCCCAGGTGCCGGGAAAGGCGGAA
TTCGCCGGGACCATCCACCACCACGTACGGGAACTGCGGGATGCCGGTGTGCCGTTGCAC
CTGGGCCGTCGCGTCGGCGGCGCGGACGTCCCGGAGCTGCGGTCGTTCGACGGTGTGGTG
CTGGCCACCGGTGTGCTCCCCGCCGGGTTGCCCCTCTCCGGCGCGGAGCTGCCCCATGTC
CGCAACTACGCGCAGGCGTTCGCCGATCCCGAAGCGCTCGGCGGCCGGATCGTCATCATC
GGCGGGGGTGGCATCGCCATCGATCTGGCGCACACCCTGACCACCGACCCGGATGCCGAG
GTGACGCCGGAGGAGTTCCTGGCCCGCCACGCCGTGGCCGGGAGCACTCCGCACTCCGGG
AGGGAACCCGCCGTCCGTGACGCGCCGCGCGAGGTGACGCTGCTGCGGCGTGGCCGGCGG
ATCGGGGCGGGCATCGGCCCCAGCACCCGCTGGGTCGTCATGCGGAATCTGAGGGCCGCC
GGTGTACGGATGCTCACCGGCGTGACCTACCGGGAGATCACACCCACCGGCGTCCTCCTC
ACCGACGCGGAAGGCACAGAGCACTCCCTGGACGCCGACCATGTCGTGCTCGCCGTTGGC
CAGGTCCCGGTGGACGAGCTGGCCCCGCTGCTGCGCGAGGCGGGTGTCCCCGTCGTCACC
GCGGGCGGCGCCGCGGGAACGGACGGGCTCAACGCCGTACGGGCCACAGCGGAAGGCCTG
CGCGCGGCGCACCGGATATCCCGCGTCGCCGTGGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001155 NADH:flavin oxidoreductase/NADH oxidase, N-terminal (Domain)
 [5-341]  1.69999999999998e-67 PF00724
PF00724   Oxidored_FMN
IPR013027 FAD-dependent pyridine nucleotide-disulphide oxidoreductase (Family)
 [393-412]  1.09999909120787e-14 PR00368 [476-494]  1.09999909120787e-14 PR00368 [516-534]  1.09999909120787e-14 PR00368 [632-648]  1.09999909120787e-14 PR00368
PR00368   FADPNR
IPR013785 Aldolase-type TIM barrel (Domain)
 [2-370]  1.20000000000001e-104 G3DSA:3.20.20.70
G3DSA:3.20.20.70   Aldolase_TIM
SignalP No significant hit
TMHMM No significant hit