close all open/close all

CDS information : Phosl_00240


close this sectionLocation

Organism
StrainHK803
Entry namePhoslactomycin
Contig
Start / Stop / Direction69,217 / 66,398 / - [in whole cluster]
69,217 / 66,398 / - [in contig]
Locationcomplement(66398..69217) [in whole cluster]
complement(66398..69217) [in contig]
TypeCDS
Length2,820 bp (939 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)PlmR1
Gene
Gene (GenBank)plmR1
EC number
Keyword
Note
Note (GenBank)
  • Regulatory
Reference
ACC
PmId
[12819191] Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster. (J Biol Chem. , 2003)
Related Reference
ACC
Q9ZGI0
NITE
Pikro_00180
PmId
[11344155] Characterization and analysis of the PikD regulatory factor in the pikromycin biosynthetic pathway of Streptomyces venezuelae. (J Bacteriol. , 2001)
[18245260] Enhanced heterologous production of desosaminyl macrolides and their hydroxylated derivatives by overexpression of the pikD regulatory gene in Streptomyces venezuelae. (Appl Environ Microbiol. , 2008)
[26608164] Interspecies Complementation of the LuxR Family Pathway-Specific Regulator Involved in Macrolide Biosynthesis. (J Microbiol Biotechnol. , 2016)

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [PlmR1]
MSDILELVLSNHAAPEFKNWHKNGGLLFLRGPKCVGKTTTLNRICASEADSGTLSLWATG
WLNEYGSPFGVLQQILDQLDAAEEGGDQPNGAGPSSSVADGPRTPSDLTFEWVYARLLKI
AARRPLLIVVDDINYVDGPSQLFLRFVARRLKGTPIRLAMAERTGCALSFCDDLRTDILR
LPYTSLVRMRLLGRKQIARSLTEHLPQFRGPFPCSAVNRMADDLHDLTGGNLLLVDVLLR
TWLTSADPMPKELTVDTAFHDCVRGMISDTDMPGMLSGAHAVAVLGDFASLPRLARLLGI
GITRASRIFGALNDLGMLAGDCLRPDMRRALLQDASFTARGELHLRAAHVLFEDSAPLTQ
VVEHLTAVGMIGAPWDLPLVLGLVNQALKSGSTDVAGRLLKLAKGSAVGPEERSAVEMML
LRTTWLTDPGLVASLLPTLGRAAFRGVLNATDLAFLVRAALWHGLTELAAELMPLMREKA
PRSPYPAEVGLAEALYSLWSGMPMDWATLELSSSSEADERYGPGADVHSLLTGLRKIHAP
ANEGDRAQAIFWAEQILQGIRVQSSAVETLLFAYTVLESLGSLRAARPWFTQLSEALEAH
PSPLWEALVSVVQAKISLELGDLGSAYRWIQKALARKPWHEWGAPIASIAALLVQTLTEM
GRPQEAAEVLDRPIPPAAYQGCGGLKYVYARGRYHLATDRLHAALADFESCRDMSASLWI
ETPARVNQAHLMVPWRCGMAEAYLALGDVAGARDALRQQLQQLPKEETSVHGTTLRLLAK
TTEDDARRLSLLKNSADTLERDGSRLQLAYTLTELAAAYRESSRLNLARTTSKRARRMAE
QCEAGRLLALVTADAHGPGRDTQPVCRHPELAELSSAERRVAVLAILGHTNREISGKLFI
TASTVEQHLTRIYRKLRVQHREDLLDKFSTVFMALEQSG
selected fasta
>putative LuxR family transcriptional regulator [PlmR1]
GTGAGCGACATCCTTGAATTAGTCCTGTCGAACCATGCGGCCCCTGAGTTCAAGAACTGG
CACAAAAATGGGGGGCTCCTCTTCCTTCGTGGGCCGAAGTGCGTAGGGAAGACCACCACG
CTCAACCGGATCTGCGCATCGGAAGCAGACTCCGGAACGCTGAGCCTGTGGGCGACGGGC
TGGCTGAACGAGTACGGTTCCCCGTTCGGGGTCCTGCAGCAGATCCTGGACCAGTTGGAC
GCGGCCGAGGAGGGCGGGGACCAGCCGAACGGCGCCGGCCCCTCGTCGTCCGTCGCGGAT
GGTCCACGGACCCCGTCCGACCTGACCTTTGAGTGGGTGTACGCCCGACTGTTGAAGATC
GCGGCGAGACGTCCCCTGCTCATAGTCGTCGACGACATCAACTACGTCGACGGCCCTTCG
CAGTTGTTCCTGCGCTTCGTGGCGCGACGGCTGAAGGGGACGCCCATCCGGCTGGCCATG
GCCGAGCGAACAGGATGCGCCCTCTCGTTCTGCGACGACCTGCGCACGGACATCCTGCGA
CTGCCGTACACCAGCCTGGTCCGGATGCGGCTCCTGGGACGCAAGCAGATCGCCCGGTCC
CTCACCGAGCACCTCCCGCAATTCCGCGGGCCCTTCCCGTGCTCGGCAGTGAACCGCATG
GCCGATGACCTCCATGACCTGACCGGCGGCAACCTGCTCCTCGTCGACGTTCTGCTGCGG
ACGTGGCTCACGTCGGCCGATCCGATGCCGAAGGAACTGACCGTCGACACGGCCTTCCAC
GACTGCGTCCGGGGCATGATCAGCGACACGGACATGCCCGGCATGCTCAGCGGCGCCCAC
GCGGTGGCCGTCCTCGGCGACTTCGCCTCCCTGCCACGACTGGCCCGACTGCTCGGGATC
GGCATCACCAGGGCCAGCAGGATCTTCGGCGCGCTCAACGACCTCGGCATGCTGGCCGGC
GACTGCCTGCGGCCCGACATGCGCCGGGCGCTGCTCCAGGACGCGAGCTTCACCGCGCGC
GGAGAGCTGCATCTGCGGGCAGCACATGTGCTTTTCGAGGACAGCGCGCCCCTGACACAG
GTCGTGGAGCATCTCACCGCGGTGGGGATGATCGGCGCGCCATGGGATCTGCCACTCGTC
CTGGGCCTCGTCAACCAGGCCCTGAAGAGCGGCAGTACGGACGTGGCCGGCAGGCTGCTC
AAGCTGGCCAAGGGCTCCGCCGTCGGCCCCGAAGAGCGCTCCGCCGTGGAGATGATGCTG
CTGCGCACCACCTGGCTGACCGACCCCGGGCTGGTGGCCTCCCTGCTGCCGACGCTGGGC
CGCGCTGCCTTCCGCGGTGTCCTGAACGCCACGGACCTGGCGTTCCTGGTGCGAGCGGCA
CTGTGGCACGGTCTGACGGAGCTGGCCGCAGAGCTGATGCCCCTGATGCGTGAGAAGGCT
CCGCGGTCCCCCTATCCGGCCGAGGTCGGTCTCGCGGAAGCGCTCTACAGCCTGTGGAGC
GGCATGCCGATGGACTGGGCGACGCTGGAATTGTCCTCGTCGAGTGAGGCCGACGAGCGT
TATGGGCCGGGTGCCGACGTGCATTCTCTGCTCACCGGTCTGCGCAAGATCCATGCCCCG
GCCAATGAGGGAGACCGGGCCCAGGCGATCTTCTGGGCCGAGCAGATACTCCAGGGCATC
CGGGTCCAGTCCTCGGCGGTGGAAACCCTGTTGTTCGCCTACACCGTGCTGGAGAGTCTG
GGCTCACTGCGCGCCGCGCGGCCGTGGTTCACCCAGCTGTCGGAGGCGCTCGAAGCGCAT
CCGTCGCCGCTGTGGGAGGCCCTGGTGTCGGTCGTGCAGGCGAAGATCTCGTTGGAGCTC
GGTGACCTCGGCTCCGCGTACCGGTGGATCCAGAAAGCGCTCGCGCGCAAGCCCTGGCAC
GAATGGGGTGCGCCGATCGCCAGTATCGCCGCGCTGCTGGTCCAGACCCTGACGGAGATG
GGCAGGCCGCAGGAGGCCGCGGAGGTACTCGACCGGCCCATTCCCCCGGCGGCGTACCAG
GGATGTGGCGGTCTGAAGTACGTCTACGCCCGCGGCAGGTATCACCTGGCGACCGATCGG
CTGCACGCGGCGCTGGCCGACTTCGAGTCGTGCAGGGACATGAGTGCCTCCCTGTGGATC
GAGACGCCCGCGCGCGTCAACCAGGCCCACCTGATGGTGCCCTGGCGCTGCGGGATGGCG
GAGGCCTATCTGGCCCTCGGGGACGTGGCGGGTGCCCGGGACGCTCTTCGGCAACAGCTG
CAACAGCTGCCCAAGGAGGAGACGTCCGTCCACGGGACCACGCTGCGCCTCCTCGCCAAG
ACCACCGAGGACGACGCCCGGCGGCTCTCCCTGCTGAAGAACTCCGCGGACACACTGGAA
CGCGATGGCAGCAGGCTGCAGCTCGCCTACACGCTGACCGAACTCGCCGCCGCCTACCGG
GAGTCCTCGCGACTGAACCTCGCCCGGACCACGTCGAAGCGGGCCCGGCGCATGGCCGAG
CAGTGCGAGGCGGGCCGACTGCTCGCGCTTGTCACCGCGGACGCCCATGGGCCCGGACGG
GACACGCAGCCGGTCTGCCGCCACCCGGAGCTCGCCGAACTGAGTTCCGCCGAACGGCGC
GTGGCGGTCCTGGCGATCCTGGGACACACGAATCGGGAGATCTCCGGGAAACTGTTCATC
ACCGCCAGCACGGTGGAGCAGCACCTGACGCGCATCTACCGCAAGCTCCGCGTGCAGCAT
CGCGAGGACCTGCTGGACAAGTTCTCCACCGTGTTCATGGCTCTCGAACAGAGCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [871-928]  4.70000326671387e-18 SM00421
SM00421   HTH_LUXR
 [874-888]  2.79999889404114e-07 PR00038 [888-904]  2.79999889404114e-07 PR00038 [904-916]  2.79999889404114e-07 PR00038
PR00038   HTHLUXR
 [872-926]  4.2e-11 PF00196
PF00196   GerE
 [888-915]  PS00622
PS00622   HTH_LUXR_1
 [867-932]  PS50043
PS50043   HTH_LUXR_2
IPR011990 Tetratricopeptide-like helical (Domain)
 [542-882]  1.2e-16 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [883-927]  4.6e-16 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [852-928]  3.50000235434314e-13 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit