close all open/close all

CDS information : Phosl_00250


close this sectionLocation

Organism
StrainHK803
Entry namePhoslactomycin
Contig
Start / Stop / Direction70,996 / 72,189 / + [in whole cluster]
70,996 / 72,189 / + [in contig]
Location70996..72189 [in whole cluster]
70996..72189 [in contig]
TypeCDS
Length1,194 bp (397 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative phospho-2-dehydro-3-deoxyheptonate aldolase
putative 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase
putative DAHP synthase
Product (GenBank)PlmI
Gene
Gene (GenBank)plmI
EC number2.5.1.54
Keyword
Note
Note (GenBank)
  • DAHP synthase
Reference
ACC
PmId
[12819191] Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster. (J Biol Chem. , 2003)
Related Reference
ACC
P80574
PmId
[8760910] Evidence for a novel class of microbial 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase in Streptomyces coelicolor A3(2), Streptomyces rimosus and Neurospora crassa. (Microbiology. , 1996)
ACC
Q6TZ03
PmId
[14600244] (De)regulation of key enzyme steps in the shikimate pathway and phenylalanine-specific pathway of the actinomycete Amycolatopsis methanolica. (Microbiology. , 2003)

close this sectionSequence

selected fasta
>putative phospho-2-dehydro-3-deoxyheptonate aldolase [PlmI]
MVGSSVTQTRNPARQQPEWADPFQAERVRTILAERPPLVRAEDVRGLGDQLAGVARGEAH
VLQAGDCAEHPDECTAGHVSRKSALLHLLGDTLQAATGKPVVRVGRIAGQFAKPRSHRVE
PVDGVDLPVYRGHMVNAPTRDLAARRHDPLRMLMAYRAAHDVMEHLGWRGPAGDSHRPGT
GTSIPTWTSHEALVLDYEFPLVRDLDDGQRLLGSTHWPWIGKRTHQLDGAHIDLISEVLN
PVAVKVGPTTTPADLTALCARLDPQRRPGRLTLIARMGADAARSCLAPLVRTVHRTGHPV
IWLCDPMHGNTVTAPDGHKTRLLPTMAEEVQAFCRAVTFAGGIAGGLHLEATPDDVTECA
PDFHALDSPTVSRTTLCDPRLNPEQAVSLVSRWRQDP
selected fasta
>putative phospho-2-dehydro-3-deoxyheptonate aldolase [PlmI]
GTGGTGGGTAGCTCCGTCACGCAGACACGCAATCCCGCCAGGCAGCAGCCCGAATGGGCC
GACCCCTTCCAGGCGGAGCGGGTACGGACGATCCTCGCCGAGCGGCCTCCTCTGGTGAGG
GCTGAGGACGTCCGCGGACTCGGTGACCAGTTGGCGGGGGTGGCGCGAGGAGAGGCCCAC
GTCCTCCAGGCCGGTGACTGCGCGGAGCACCCCGACGAGTGCACGGCGGGACATGTCTCG
CGCAAGTCCGCCCTGCTTCACCTGCTCGGCGACACCCTGCAGGCCGCGACCGGCAAACCG
GTTGTGCGCGTGGGGCGCATCGCCGGCCAGTTCGCCAAGCCCCGCTCGCACCGGGTCGAA
CCGGTCGATGGTGTCGACCTGCCCGTCTATCGCGGACACATGGTCAACGCCCCCACTCGC
GACCTCGCCGCCCGCCGCCACGACCCCCTGCGGATGCTGATGGCCTACCGGGCGGCCCAC
GACGTCATGGAGCATCTCGGCTGGCGCGGCCCCGCCGGCGACTCACACCGCCCCGGTACC
GGTACCTCGATTCCGACCTGGACCAGCCACGAAGCACTTGTCCTGGACTACGAATTCCCC
CTGGTCCGTGACCTGGACGACGGACAACGTCTTCTCGGCTCCACCCATTGGCCCTGGATC
GGCAAGCGCACCCATCAGCTCGACGGTGCCCATATCGACCTGATCTCCGAGGTGCTCAAC
CCCGTTGCGGTGAAGGTCGGTCCCACGACCACCCCGGCCGACCTCACCGCGCTGTGTGCC
CGCCTCGACCCACAGCGCCGTCCGGGCCGCCTCACGCTCATCGCCCGCATGGGGGCCGAT
GCGGCACGCTCCTGCCTCGCCCCGCTCGTCCGGACCGTCCACCGTACCGGCCACCCGGTG
ATCTGGCTGTGCGACCCCATGCACGGCAACACCGTCACCGCCCCCGACGGCCACAAGACC
CGCTTGCTGCCCACCATGGCGGAGGAAGTGCAGGCCTTCTGCCGGGCCGTCACCTTCGCC
GGTGGCATCGCCGGCGGACTCCACCTGGAGGCCACACCCGACGACGTCACCGAATGCGCC
CCCGACTTCCACGCCCTCGACTCCCCCACCGTCAGCCGTACCACCCTGTGCGACCCCCGC
CTCAACCCTGAACAGGCCGTCTCACTCGTCTCCCGGTGGCGCCAAGACCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002480 DAHP synthetase, class II (Family)
 [9-166]  5.19999999999996e-52 PF01474 [182-391]  2.50000000000001e-79 PF01474
PF01474   DAHP_synth_2
SignalP
 [1-41]  0.071 Signal
Eukaryota   
 [1-41]  0.103 Signal
Bacteria, Gram-negative   
TMHMM No significant hit