close all open/close all

CDS information : Phosl_00260


close this sectionLocation

Organism
StrainHK803
Entry namePhoslactomycin
Contig
Start / Stop / Direction73,871 / 72,672 / - [in whole cluster]
73,871 / 72,672 / - [in contig]
Locationcomplement(72672..73871) [in whole cluster]
complement(72672..73871) [in contig]
TypeCDS
Length1,200 bp (399 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)PlmS2
Gene
Gene (GenBank)plmS2
EC number
Keyword
  • C-18 hydroxylate
Note
Note (GenBank)
  • cytochrome P450
Reference
ACC
PmId
[12819191] Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster. (J Biol Chem. , 2003)
[16291670] The plmS2-encoded cytochrome P450 monooxygenase mediates hydroxylation of phoslactomycin B in Streptomyces sp. strain HK803. (J Bacteriol. , 2005)
[16609856] Genetic manipulation of the biosynthetic process leading to phoslactomycins, potent protein phosphatase 2A inhibitors. (J Ind Microbiol Biotechnol. , 2006)

close this sectionSequence

selected fasta
>cytochrome P450 [PlmS2]
MVTVDLSAYGPGFFTDPYPYYARLREAGPVHEIVLADGDRFWLIVGYDEARAALADPRLA
KSLDPPSEDERHVLITDPPDHTRLRRLVSREFTARRVEAMRPRVQEITDGLLDEMVAGRR
RADLVPSLGSPLPITVLCELLGVPLADREDFRGWTERVLVPAEPDTIAWWKSRGFAQAGM
ALTDYLKNMIEDKRRSTPTGDLISSLLRTTAEDNDRLSAAELHSMVFILIVAGHETTANL
ITNGVRALLAHPEQLAALRTDPEGLIDQAVEEMLRYDGPVETSTKRFTLEAVRYGATKIP
PGETLLVSIAATGRDPAQFERPDTFDIHRGTTGTRSGHVAFGHGIHFCLGAGLARMESRV
AILTLLRRCPDLALDIDPAGLDWLPGIRVRGVRSLPVRW
selected fasta
>cytochrome P450 [PlmS2]
ATGGTGACCGTCGACCTGAGCGCGTACGGCCCCGGTTTCTTCACCGACCCGTACCCCTAC
TACGCCCGGCTGCGCGAGGCCGGGCCGGTGCACGAGATCGTCTTGGCCGACGGGGACAGG
TTCTGGCTGATCGTCGGCTACGACGAGGCCCGGGCGGCCCTGGCCGATCCACGTCTGGCC
AAGTCCCTCGACCCGCCGAGCGAGGACGAGCGGCACGTCCTGATCACCGATCCGCCGGAC
CACACGCGGCTGCGACGGCTCGTCTCGCGGGAGTTCACCGCGCGCCGGGTGGAGGCGATG
CGCCCGCGCGTTCAGGAGATCACCGACGGTCTCCTCGATGAGATGGTGGCCGGGCGGCGG
CGAGCCGACCTGGTCCCGTCGCTGGGGTCCCCGCTGCCGATCACCGTGCTCTGCGAACTG
CTCGGGGTCCCGCTCGCCGACCGGGAGGACTTCCGCGGCTGGACGGAGCGGGTTCTGGTG
CCGGCCGAACCGGACACCATAGCCTGGTGGAAGAGCCGGGGATTCGCGCAGGCCGGGATG
GCCCTGACGGACTACCTGAAGAACATGATCGAGGACAAGCGCCGCTCTACGCCGACCGGC
GACCTGATCTCCTCGCTGTTGCGGACAACCGCGGAGGACAACGACCGCCTGTCGGCCGCC
GAGCTGCACTCGATGGTGTTCATCCTGATCGTTGCGGGCCACGAGACCACGGCCAACCTG
ATCACCAACGGCGTACGCGCGCTCCTGGCACACCCCGAACAACTGGCGGCGCTGCGTACC
GACCCGGAGGGACTGATCGACCAGGCGGTCGAGGAGATGCTGCGCTACGACGGCCCGGTG
GAGACGTCGACCAAGCGGTTCACCCTCGAGGCCGTCAGATACGGCGCCACGAAGATCCCG
CCAGGGGAGACGCTTCTGGTCAGCATCGCGGCGACGGGGCGTGACCCTGCGCAGTTCGAG
CGACCCGACACGTTCGACATCCACCGCGGTACGACCGGCACCCGCAGTGGCCACGTCGCC
TTCGGCCACGGCATCCACTTCTGCCTGGGTGCCGGGCTGGCACGGATGGAGAGCCGGGTC
GCGATCCTGACCCTGCTGCGCCGCTGTCCCGACCTGGCGCTCGACATCGATCCGGCCGGT
CTCGACTGGCTGCCGGGCATCAGAGTCCGGGGTGTACGCAGTCTGCCGGTGCGCTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [8-399]  2.09999999999996e-110 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [69-369]  1e-33 PF00067
PF00067   p450
 [6-399]  6.4999795054176e-96 SSF48264
SSF48264   Cytochrome_P450
IPR002397 Cytochrome P450, B-class (Family)
 [76-87]  1.40000506907309e-47 PR00359 [123-139]  1.40000506907309e-47 PR00359 [140-155]  1.40000506907309e-47 PR00359 [185-207]  1.40000506907309e-47 PR00359 [268-279]  1.40000506907309e-47 PR00359 [286-313]  1.40000506907309e-47 PR00359 [314-329]  1.40000506907309e-47 PR00359 [339-348]  1.40000506907309e-47 PR00359 [348-359]  1.40000506907309e-47 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [341-350]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit