close all open/close all

CDS information : Phosl_00270


close this sectionLocation

Organism
StrainHK803
Entry namePhoslactomycin
Contig
Start / Stop / Direction74,785 / 73,865 / - [in whole cluster]
74,785 / 73,865 / - [in contig]
Locationcomplement(73865..74785) [in whole cluster]
complement(73865..74785) [in contig]
TypeCDS
Length921 bp (306 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
ProductC-18 O-acyltransferase
Product (GenBank)PlmS3
Gene
Gene (GenBank)plmS3
EC number2.3.1.-
Keyword
Note
Note (GenBank)
  • putative hydrolase
Reference
ACC
PmId
[12819191] Enhancement and selective production of phoslactomycin B, a protein phosphatase IIa inhibitor, through identification and engineering of the corresponding biosynthetic gene cluster. (J Biol Chem. , 2003)
[16609856] Genetic manipulation of the biosynthetic process leading to phoslactomycins, potent protein phosphatase 2A inhibitors. (J Ind Microbiol Biotechnol. , 2006)
[19304832] Application of a newly identified and characterized 18-o-acyltransferase in chemoenzymatic synthesis of selected natural and nonnatural bioactive derivatives of phoslactomycins. (Appl Environ Microbiol. , 2009)

close this sectionSequence

selected fasta
>C-18 O-acyltransferase [PlmS3]
MADSLAAEQVRQFSYQGYEFACRIVECPAPVTEPIVVLCGAFQNIRSYHRYDKYWHDSAT
LICMEPPGSYSPDPVPRTVGYDFDAGALAYLLDELDLPRINLLGVSLGAAPTHRFAQEYP
ERLARLMLTGAAWGDTARRGAVELEHWLGLRRADEFGRTMVELCVNGDPTRTVRNREAVR
RALLDHLSTASEAEMVRYLAVAQRLVDHPATLPGRISGIPALCVTGEHDDLAPPDLARRM
AAGIDGAAFTTIRETCHVSFLERHADWADLVLRFFTDQSLAGLDYLTGLEHPARRPEHEE
TASSAW
selected fasta
>C-18 O-acyltransferase [PlmS3]
ATGGCCGACAGCCTTGCGGCCGAACAGGTCAGGCAATTCTCGTACCAGGGCTACGAATTC
GCCTGCCGGATCGTTGAGTGCCCGGCACCGGTCACCGAGCCGATAGTCGTCTTGTGCGGG
GCGTTCCAGAACATCCGCAGCTACCACCGCTACGACAAGTACTGGCACGACTCGGCCACC
CTCATCTGCATGGAGCCGCCGGGCTCGTACTCGCCCGATCCGGTGCCGCGGACCGTCGGA
TACGACTTCGACGCCGGCGCGCTGGCCTATCTGCTCGACGAACTGGATCTGCCCCGCATC
AACCTGCTCGGCGTCAGCCTGGGCGCCGCGCCCACGCACCGGTTCGCCCAGGAGTACCCG
GAGCGGCTCGCGCGGCTGATGCTCACCGGCGCGGCGTGGGGCGACACCGCACGTCGCGGG
GCCGTCGAACTCGAACACTGGCTGGGGCTGCGCCGGGCGGACGAATTCGGGCGCACGATG
GTGGAACTGTGCGTGAACGGGGACCCGACCCGGACCGTACGCAATCGGGAGGCCGTCCGG
CGCGCTCTGCTCGACCATCTGAGCACGGCGTCGGAGGCTGAAATGGTGCGGTACCTCGCC
GTCGCCCAGCGATTGGTCGACCATCCGGCGACGCTACCGGGCCGGATCTCCGGGATACCC
GCCCTGTGCGTGACCGGGGAGCACGACGACCTCGCTCCCCCCGATCTGGCGCGGAGGATG
GCCGCCGGCATCGACGGCGCGGCGTTCACGACCATTCGCGAGACCTGCCACGTGTCCTTC
CTGGAACGCCATGCCGACTGGGCCGACCTGGTGCTGCGGTTCTTCACCGACCAGTCGCTG
GCCGGCCTCGACTACCTGACCGGCCTGGAACATCCGGCCCGCCGCCCCGAGCACGAAGAG
ACGGCGTCCTCCGCATGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000073 Alpha/beta hydrolase fold-1 (Domain)
 [102-115]  3.99999861686541e-05 PR00111 [116-129]  3.99999861686541e-05 PR00111 [221-235]  3.99999861686541e-05 PR00111
PR00111   ABHYDROLASE
SignalP No significant hit
TMHMM No significant hit