close all open/close all
first first   Pier_00020 Pier_00020

CDS information : Pier_00010


close this sectionLocation

Organism
Strain
Entry namePiericidin
Contig
Start / Stop / Direction1 / 600 / + [in whole cluster]
1 / 600 / + [in contig]
Location1..600 [in whole cluster]
1..600 [in contig]
TypeCDS
Length600 bp (199 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator(fragment)
Product (GenBank)PieR
GenepieR
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • transcriptional regulator
Reference
ACC
PmId
[22365607] Elucidation of Piericidin A1 biosynthetic locus revealed a thioesterase-dependent mechanism of alpha-pyridone ring formation. (Chem Biol. , 2012)
Related Reference
ACC
Q70DY8
NITE
Pimar_00030
PmId
[15090496] Identification of PimR as a positive regulator of pimaricin biosynthesis in Streptomyces natalensis. (J Bacteriol. , 2004)
[22693644] Hierarchical Control on Polyene Macrolide Biosynthesis: PimR Modulates Pimaricin Production via the PAS-LuxR Transcriptional Activator PimM. (PLoS One. , 2012)
ACC
Q2MGB3
NITE
Fred_00260
PmId
[18556785] Identification and utility of FdmR1 as a Streptomyces antibiotic regulatory protein activator for fredericamycin production in Streptomyces griseus ATCC 49344 and heterologous hosts. (J Bacteriol. , 2008)

close this sectionSequence

selected fasta
>putative transcriptional regulator(fragment) [PieR]
MANLHSYVSNLRRLLEPNRPPRSRDTVLRREATGYVLTVDDDCIDAFRFERLLHEGRRQL
QAGLHQNARRTLERALALWRGSAYPEVSDYAVGAQAASRFEELRLLALESLWEAALAEER
DFSMIAAELPALATRFPARERFSWLLMKALYRSGRRAEAIDAYHRTRRTLAEEYGVDPGN
ELQELFGTILRGERLAGSA
selected fasta
>putative transcriptional regulator(fragment) [PieR]
ATGGCGAACCTGCACAGCTACGTCTCCAATCTCCGGCGGCTGCTGGAGCCGAACCGGCCG
CCGCGCAGCCGGGACACGGTCCTGCGGCGGGAGGCCACCGGCTACGTGCTGACGGTGGAC
GACGACTGCATCGACGCGTTCCGCTTCGAGCGGCTGCTGCACGAGGGCCGGCGGCAGCTC
CAGGCCGGGCTGCACCAGAACGCGCGCCGGACCCTGGAGCGGGCGCTGGCGCTGTGGCGC
GGGTCCGCGTATCCGGAGGTGAGCGACTACGCGGTGGGCGCCCAGGCGGCCTCGCGGTTC
GAGGAGTTGAGACTCCTGGCGCTGGAGAGCCTCTGGGAGGCCGCGCTGGCCGAGGAGCGC
GACTTCTCGATGATCGCCGCCGAACTCCCCGCGCTCGCCACGCGGTTCCCGGCCCGGGAG
CGGTTCAGCTGGCTGTTGATGAAGGCGCTCTACCGGTCCGGCCGGCGGGCCGAGGCGATC
GACGCGTACCACCGGACCCGCCGGACGCTGGCGGAGGAGTACGGCGTGGACCCCGGGAAC
GAGTTGCAGGAGCTGTTCGGCACCATCCTGCGCGGCGAGCGCCTCGCCGGGTCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005158 Bacterial transcriptional activator domain (Domain)
 [44-190]  4.30000000000003e-38 PF03704
PF03704   BTAD
 [44-190]  1.60000240695997e-40 SM01043
SM01043   BTAD
SignalP No significant hit
TMHMM No significant hit
first first   Pier_00020 Pier_00020