close all open/close all

CDS information : Pier_00040


close this sectionLocation

Organism
Strain
Entry namePiericidin
Contig
Start / Stop / Direction19,078 / 23,544 / + [in whole cluster]
19,078 / 23,544 / + [in contig]
Location19078..23544 [in whole cluster]
19078..23544 [in contig]
TypeCDS
Length4,467 bp (1,488 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)PieA3
GenepieA3
Gene (GenBank)
EC number
Keyword
Note
  • Nucleotide sequence of this entry may be wrongly registered. Though this ORF corresponds to PieA3, intact ORF cannot be assigned due to frameshift.
Note (GenBank)
  • PKS
Reference
ACC
PmId
[22365607] Elucidation of Piericidin A1 biosynthetic locus revealed a thioesterase-dependent mechanism of alpha-pyridone ring formation. (Chem Biol. , 2012)

close this sectionPKS/NRPS Module

4
KS34..409
AT589..688
DH811..978

close this sectionSequence

selected fasta
>polyketide synthase [PieA3]
MTSDEKVLDTLKRLTIDLRRTRRRLQEVEEAAREPIAIVGMACRFPGGVASPEDLWRLVA
EERDVISPFPADRGWSEGLYDPDPARHGSVYVREGGFLYDAAEFDPAFFGMSAREALATD
PQQRLLLETAWEAFERAGIDPASVRGTRTGVFAGVIYQDYASRLRRVPGEFEGYVGNGST
GSVASGRVAYTFGLEGPAVTLDTACSSSLVALHQAAQALRNGDCSLALAGGVTVMASPMA
LVEFSRQRGLATDARCKAFAAGADGTGLGEGVGMLLLERLSDARRNGRRVLAVIRGSAVN
QDGASSGLTAPSGPAQQRVIRQALEHAGLTAREVDAVEAHGTGTTLGDPIEAQALLATYG
QDRSGEEPLYLGSVKSNIGHAQAAAGVAGVIKTVMAIRHGVLPRTLHFDEPNPHVDWSAG
AVSPLTGAREWPATGRPRRAGVSSFGVSGTNAHLILEQATEETAAEEAAADLPVQEAGPR
PAAGASVPWVLSGRTGAALRAQAARLLDHLAAHPEQTAAEVGAALARHRAAFEHRAVLLG
ANLGELRAGLAALAAGEARSGLVTGVARDDGPVVFVLPDSPLERPDRVVQLLDTTPLFAA
RLAECDAALREVAGWSATDVLRGAAGAPDPARPEVGRAVAWAVLVALAGLWAEHGVDPAA
VVAPGAGTVAGACVAGALSLVDGARAAVSGEAATLTESRIPLLTDAVDASLRTLLERGHS
RFVVLGTDRAERITAVVGPDVQVIAAADGFLPALADLHVHGAAVRFSAGFPVAGLRPVDL
PTYAFQRRRYWLEDGPDDPDVTAAGLTAAGHPLLRALVELPDEGGLLFTGRLSPRELPWL
ADHTVQGRVLLPGTAVVELVREAGAQTGCPHLGELTLHAPLELPGPEAAAEAGVRIRLTV
DAADGSGHRAVELSSRPAVPEDAAWTRHATGTLTPDAPAVSSDLVAWPPAGAEPVGLDGC
YRRFADLGIDYGPAFRGLRALWRRGEEVFAEVALAIGGPGRCRPLRPPPGAAGRRPAGLR
GRGGAGGRADAGAVRLARRLGPGRRRDGPAGAARPGRPGRGDRRGRRPGGRAGGHGGEPA
LPPAARGRRRLRRPVARPLGAGVAGPAPGRRADGGGGHRTAGRLAGAPPRPRRAGRRRHP
RAGRGPRAARSDGRRRADRRPRRHGGRAPAGPHLAGRAAVRGRATGRGDERRPVHRRRRP
RPRPRGGGRLGSAPVRPVRTPPALRPAGPRRGDAHRGRAGGGTRLRRAPAGAPPDRSAGT
AAGGGRAGRRRRHRRLRPGRHRPGHRRHRHPGRPARPAPGRARRPAPPAGGPPGREDAGR
GRAGGGTGRAGGRDHRRRLRHRRPGGPGRPAAVGPRGPPAAGGRARGRRGRRRPAHHAHA
RAACRRPAAEGRRGLAPARADPRRRARRLRAVLLRLGHLRHRRTGQLRGRQRLPRRARAA
APRRGPARSFPGLGAVGGAQQADGGSGPPQHGPVGQGRRRRAFDAGGT
selected fasta
>polyketide synthase [PieA3]
ATGACGAGCGACGAGAAGGTCCTCGACACCCTCAAGCGGCTGACCATCGACCTGCGCCGG
ACGCGCCGGCGGCTGCAGGAGGTCGAGGAGGCGGCCCGCGAGCCGATCGCGATCGTCGGC
ATGGCGTGCCGCTTCCCCGGCGGGGTCGCCTCCCCCGAGGACCTCTGGCGGCTGGTGGCC
GAGGAGCGGGACGTGATCTCCCCGTTCCCGGCCGACCGCGGCTGGAGCGAGGGCCTCTAC
GACCCGGACCCGGCCCGGCACGGCTCGGTGTACGTCCGCGAGGGCGGGTTCCTGTACGAC
GCCGCCGAGTTCGACCCGGCGTTCTTCGGCATGAGCGCCCGGGAGGCGCTGGCCACCGAC
CCGCAGCAGCGGCTGCTGCTCGAAACGGCCTGGGAGGCCTTCGAGCGGGCCGGGATCGAC
CCGGCGTCGGTGCGCGGCACCCGGACCGGCGTCTTCGCCGGGGTGATCTACCAGGACTAC
GCCTCGCGACTGCGCCGGGTGCCGGGCGAGTTCGAGGGCTACGTCGGCAACGGCAGCACC
GGCAGCGTCGCCTCCGGCCGGGTCGCGTACACCTTCGGCCTGGAGGGCCCGGCCGTCACG
CTGGACACCGCGTGCTCCTCGTCGCTGGTGGCGCTGCACCAGGCCGCGCAGGCGCTGCGG
AACGGCGACTGCTCGCTGGCGCTGGCCGGCGGGGTGACCGTGATGGCCTCGCCGATGGCG
CTGGTCGAGTTCAGCCGGCAGCGCGGCCTGGCCACCGACGCGCGGTGCAAGGCCTTCGCG
GCCGGGGCCGACGGCACGGGCCTCGGCGAGGGCGTCGGGATGCTGCTGCTGGAGCGGCTG
TCGGACGCCCGGCGCAACGGGCGCCGGGTGCTCGCGGTGATCCGGGGCAGCGCGGTCAAC
CAGGACGGCGCCAGCAGCGGGCTGACGGCGCCGAGCGGGCCCGCCCAGCAGCGGGTGATC
CGGCAGGCGCTGGAGCACGCAGGCCTGACCGCCCGCGAGGTGGACGCGGTGGAGGCGCAC
GGCACCGGGACGACGCTCGGCGATCCGATCGAGGCACAGGCGCTGCTCGCCACCTACGGC
CAGGACCGGTCCGGCGAGGAGCCGCTGTACCTCGGCTCGGTGAAGTCCAACATCGGCCAC
GCGCAGGCGGCGGCCGGTGTGGCGGGCGTGATCAAGACCGTGATGGCGATCCGGCACGGC
GTGCTGCCGCGCACCCTCCACTTCGACGAGCCCAATCCGCACGTGGACTGGTCGGCGGGC
GCGGTGTCGCCGTTGACCGGGGCCCGGGAGTGGCCGGCCACCGGGCGGCCGCGCCGGGCC
GGCGTGTCGTCCTTCGGGGTCAGCGGGACCAACGCGCACCTCATCCTGGAGCAGGCCACC
GAGGAGACCGCCGCCGAGGAAGCCGCCGCCGACCTCCCGGTGCAGGAGGCCGGGCCGCGG
CCCGCCGCCGGGGCGTCCGTGCCGTGGGTGCTCTCCGGCCGGACCGGAGCCGCGCTGCGC
GCGCAGGCCGCGCGGCTGCTGGACCACTTGGCCGCGCATCCCGAGCAGACGGCGGCCGAG
GTCGGTGCGGCACTGGCGCGCCACCGGGCGGCCTTCGAGCACCGGGCCGTGCTGCTGGGC
GCAAACCTCGGCGAGCTGCGGGCGGGCCTGGCGGCGCTGGCCGCGGGCGAGGCCCGGTCC
GGCCTGGTCACGGGCGTCGCCCGGGACGACGGCCCGGTGGTGTTCGTCCTGCCGGATTCG
CCGCTGGAGCGTCCGGACCGGGTGGTGCAGCTACTGGACACCACACCGCTGTTCGCCGCG
CGGCTCGCCGAGTGCGACGCCGCGCTGCGCGAGGTCGCCGGCTGGTCCGCGACGGACGTG
CTGCGCGGCGCCGCGGGCGCGCCCGATCCGGCGCGTCCCGAGGTCGGCCGGGCGGTGGCG
TGGGCGGTGCTGGTGGCCCTCGCCGGGCTCTGGGCGGAGCACGGGGTGGACCCGGCCGCC
GTGGTGGCACCGGGTGCCGGCACGGTGGCCGGTGCCTGCGTCGCGGGGGCGCTGTCCCTG
GTGGACGGTGCGCGCGCGGCGGTCTCCGGCGAGGCGGCCACCCTGACGGAGAGCCGGATT
CCGCTGCTCACCGACGCCGTGGACGCCTCCCTGCGCACGCTGCTGGAGCGCGGGCACAGC
CGTTTCGTCGTCCTCGGCACCGACCGGGCCGAACGGATCACCGCCGTCGTCGGGCCCGAC
GTCCAGGTGATCGCCGCCGCGGACGGGTTCCTCCCCGCGCTGGCCGACCTGCACGTCCAC
GGCGCGGCGGTCCGCTTCTCGGCGGGGTTCCCGGTCGCCGGGCTCCGCCCGGTGGACCTG
CCGACCTACGCCTTCCAGCGCCGGCGGTACTGGCTGGAGGACGGACCGGACGACCCCGAC
GTGACCGCCGCCGGCCTCACGGCCGCAGGCCACCCGCTGCTCCGGGCCCTGGTCGAACTG
CCGGACGAAGGCGGGCTGTTGTTCACCGGCCGGCTCTCCCCGCGCGAGCTGCCCTGGCTC
GCCGACCACACCGTGCAGGGCCGGGTGCTGCTGCCCGGCACCGCCGTGGTCGAGCTGGTC
CGCGAGGCCGGCGCGCAGACGGGCTGCCCGCACCTGGGCGAGCTGACCCTGCACGCCCCG
CTGGAGCTGCCCGGACCCGAGGCCGCCGCGGAGGCCGGCGTCCGGATCCGGCTGACCGTC
GACGCCGCGGACGGCTCCGGTCACCGCGCGGTGGAGCTGTCCTCGCGCCCGGCCGTTCCC
GAGGACGCCGCCTGGACCCGGCACGCCACCGGCACGCTGACGCCCGACGCGCCGGCCGTC
TCGTCCGACCTGGTCGCCTGGCCGCCGGCCGGCGCCGAGCCGGTCGGCCTGGACGGCTGC
TACCGCCGCTTCGCCGACCTCGGCATCGACTACGGCCCGGCCTTCCGCGGGCTGCGCGCG
CTCTGGCGGCGCGGCGAGGAGGTGTTCGCCGAGGTGGCGCTGGCGATAGGAGGACCGGGT
CGATGCCGGCCGCTACGGCCTCCACCCGGCGCTGCTGGACGCCGCCCTGCAGGCCTACGC
GGCCGGGGCGGAGCAGGCGGACGGGCCGACGCCGGTGCCGTTCGCCTGGCACGGCGTCTC
GGTCCGGGCCGCCGGCGCGACGGCCCTGCGGGTGCGGCTCGCCCCGGCCGGCCCGGACGC
GGTGACCGTCGAGGCCGCCGACCCGGCGGGCGTGCCGGTGGCCACGGTGGCGAGCCTGCG
CTCCCGCCGGCTGCCCGGGGCCGCCGCCGGCTCCGGCGCCCTGTGGCGCGTCCGCTGGGC
GCCGGTGTCGCCGGCCCCGCACCCGGCCGCCGTGCGGACGGCGGTGGTGGGCACCGGACT
GCCGGACGCCTCGCCGGAGCGCCACCCCGACCTCGCCGCGCTGGCCGCCGCCGGCACCCC
CGTGCCGGACGTGGTCCTCGTGCCGCTCGCTCCGACGGGCGGCGACGTGCCGACCGCCGT
CCACGCCGCCACGGCGGACGCGCTCCGGCTGGTCCGCACCTGGCTGGCCGAGCCGCGGTT
CGCGGCCGCGCGACTGGTCGTGGTGACGAACGGCGCCCAGTCCACCGGCGCCGGCGACCC
CGCCCCCGACCTCGCGGCGGCGGCCGTCTGGGGTCTGCTCCGGTCCGCCCAGTCCGAACA
CCCCCGGCGCTTCGGCCTGCTGGACCTCGACGGGGCGACGCCCACCGCGGCCGAGCTGGC
GGCGGCACTCGCCTCCGACGAGCCCCAGCTGGCGCTCCGCCGGACCGGTCTGCTGGCACC
GCGGCTGGCGGAGGCCGAGCCGGTCGCCGGCGGCGGCACCGCCGCCTTCGACCCGGACGG
CACCGTCCTGGTCACCGGCGGCACCGGCACCCTGGGCGGCCTGCTCGCCCGGCACCTGGT
CGAGCGCGGCGCCCGGCACCTCCTGCTGGCGGGCCGCCGGGGCGAGAAGACGCCGGGCGT
GGCCGGGCTGGTGGCGGAACTGGCCGAGCGGGGGGCCGAGATCACCGTCGCCGCCTGCGA
CACCGCCGACCGGGAGGCCCTGGCCGCCCTGCTGCGGTCGGTCCCCGCGGCCCACCCGCT
GCGGGCGGTCGTGCACGCGGCCGGCGTGGCCGACGACGGCCTGCTCACCACGCTCACGCC
CGAGCGGCTTGCCGCCGTCCTGCTGCCGAAGGTCGACGCGGCCTGGCACCTGCACGAGCT
GACCCGCGACGCCGGGCTCGACGCCTTCGTGCTGTTCTCCTCCGCCTCGGGCACCTTCGG
CACCGCCGGACAGGCCAACTACGCGGCCGCCAACGCCTTCCTCGACGCGCTCGCGCAGCG
GCGCCACGCCGAGGGCCTGCCCGGTCTTTCCCTGGCCTGGGGGCTGTGGGCGGAGCGCAG
CAAGCTGACGGAGGGTCTGGACCCCCTCAGCATGGGCCGGTTGGCCAGGGACGGCGTCGG
CGCGCTTTCGACGCCGGAGGCACTTGA
[4] KS34..409
[4] AT589..688
[4] DH811..978
[4] KS100..1227
[4] AT1765..2064
[4] DH2431..2934

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [565-687]  3.1e-13 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-283]  1.10000000000001e-95 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [291-409]  1.40000000000001e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [589-688]  4.70000000000001e-15 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  1.5e-06 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [572-688]  5.50000546509999e-13 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016038 Thiolase-like, subgroup (Domain)
 [33-294]  1e-88 G3DSA:3.40.47.10 [295-462]  1.5e-66 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-407]  6.59996953923913e-103 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [196-212]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [811-978]  2.89997807423187e-76 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-461]  SM00825
SM00825   PKS_KS
SignalP No significant hit
TMHMM No significant hit