close all open/close all

CDS information : Pier_00045


close this sectionLocation

Organism
Strain
Entry namePiericidin
Contig
Start / Stop / Direction22,172 / 24,253 / + [in whole cluster]
22,172 / 24,253 / + [in contig]
Location22172..24253 [in whole cluster]
22172..24253 [in contig]
TypeCDS
Length2,082 bp (693 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)
GenepieA3
Gene (GenBank)
EC number
Keyword
Note
  • Nucleotide sequence of this entry may be wrongly registered. Though this ORF corresponds to PieA3, intact ORF cannot be assigned due to frameshift.
Note (GenBank)
Reference
ACC
PmId
[22365607] Elucidation of Piericidin A1 biosynthetic locus revealed a thioesterase-dependent mechanism of alpha-pyridone ring formation. (Chem Biol. , 2012)

close this sectionPKS/NRPS Module

4
KR249..428
ACP539..613

close this sectionSequence

selected fasta
>polyketide synthase
MPFAWHGVSVRAAGATALRVRLAPAGPDAVTVEAADPAGVPVATVASLRSRRLPGAAAGS
GALWRVRWAPVSPAPHPAAVRTAVVGTGLPDASPERHPDLAALAAAGTPVPDVVLVPLAP
TGGDVPTAVHAATADALRLVRTWLAEPRFAAARLVVVTNGAQSTGAGDPAPDLAAAAVWG
LLRSAQSEHPRRFGLLDLDGATPTAAELAAALASDEPQLALRRTGLLAPRLAEAEPVAGG
GTAAFDPDGTVLVTGGTGTLGGLLARHLVERGARHLLLAGRRGEKTPGVAGLVAELAERG
AEITVAACDTADREALAALLRSVPAAHPLRAVVHAAGVADDGLLTTLTPERLAAVLLPKV
DAAWHLHELTRDAGLDAFVLFSSASGTFGTAGQANYAAANAFLDALAQRRHAEGLPGLSL
AWGLWAERSKLTEGLDPLSMGRLARDGVGALSTPEALDLFDTARIMINESVLVPVRLDLA
VLRGRSDQGQVPSLLRESATAPVPTAAVSAPAPGPDHEQEQDRTTGFAQRLRAMPEADRR
RALLDLVRTHAAVVLAESTPESIDPGQGFVDLGFDSLANLELQERLQDATGLQLPSTLVF
DYPTAEVLADHLCAEFDTGETTAVGPALAELDRLEQFLTPYTDDDQARTAITHRLKDLLA
RWGDDGRDGTDRPDLASATDDELFDVLDQLRAR
selected fasta
>polyketide synthase
GTGCCGTTCGCCTGGCACGGCGTCTCGGTCCGGGCCGCCGGCGCGACGGCCCTGCGGGTG
CGGCTCGCCCCGGCCGGCCCGGACGCGGTGACCGTCGAGGCCGCCGACCCGGCGGGCGTG
CCGGTGGCCACGGTGGCGAGCCTGCGCTCCCGCCGGCTGCCCGGGGCCGCCGCCGGCTCC
GGCGCCCTGTGGCGCGTCCGCTGGGCGCCGGTGTCGCCGGCCCCGCACCCGGCCGCCGTG
CGGACGGCGGTGGTGGGCACCGGACTGCCGGACGCCTCGCCGGAGCGCCACCCCGACCTC
GCCGCGCTGGCCGCCGCCGGCACCCCCGTGCCGGACGTGGTCCTCGTGCCGCTCGCTCCG
ACGGGCGGCGACGTGCCGACCGCCGTCCACGCCGCCACGGCGGACGCGCTCCGGCTGGTC
CGCACCTGGCTGGCCGAGCCGCGGTTCGCGGCCGCGCGACTGGTCGTGGTGACGAACGGC
GCCCAGTCCACCGGCGCCGGCGACCCCGCCCCCGACCTCGCGGCGGCGGCCGTCTGGGGT
CTGCTCCGGTCCGCCCAGTCCGAACACCCCCGGCGCTTCGGCCTGCTGGACCTCGACGGG
GCGACGCCCACCGCGGCCGAGCTGGCGGCGGCACTCGCCTCCGACGAGCCCCAGCTGGCG
CTCCGCCGGACCGGTCTGCTGGCACCGCGGCTGGCGGAGGCCGAGCCGGTCGCCGGCGGC
GGCACCGCCGCCTTCGACCCGGACGGCACCGTCCTGGTCACCGGCGGCACCGGCACCCTG
GGCGGCCTGCTCGCCCGGCACCTGGTCGAGCGCGGCGCCCGGCACCTCCTGCTGGCGGGC
CGCCGGGGCGAGAAGACGCCGGGCGTGGCCGGGCTGGTGGCGGAACTGGCCGAGCGGGGG
GCCGAGATCACCGTCGCCGCCTGCGACACCGCCGACCGGGAGGCCCTGGCCGCCCTGCTG
CGGTCGGTCCCCGCGGCCCACCCGCTGCGGGCGGTCGTGCACGCGGCCGGCGTGGCCGAC
GACGGCCTGCTCACCACGCTCACGCCCGAGCGGCTTGCCGCCGTCCTGCTGCCGAAGGTC
GACGCGGCCTGGCACCTGCACGAGCTGACCCGCGACGCCGGGCTCGACGCCTTCGTGCTG
TTCTCCTCCGCCTCGGGCACCTTCGGCACCGCCGGACAGGCCAACTACGCGGCCGCCAAC
GCCTTCCTCGACGCGCTCGCGCAGCGGCGCCACGCCGAGGGCCTGCCCGGTCTTTCCCTG
GCCTGGGGGCTGTGGGCGGAGCGCAGCAAGCTGACGGAGGGTCTGGACCCCCTCAGCATG
GGCCGGTTGGCCAGGGACGGCGTCGGCGCGCTTTCGACGCCGGAGGCACTTGATCTCTTC
GACACCGCCCGTATCATGATCAATGAGTCGGTGCTCGTCCCCGTTCGACTGGACCTCGCG
GTACTGCGGGGCCGGTCCGACCAGGGACAAGTTCCCTCGCTGCTGCGGGAGTCGGCCACG
GCGCCGGTGCCCACGGCGGCGGTGTCGGCGCCCGCGCCGGGGCCGGACCACGAGCAGGAG
CAGGACCGGACGACCGGCTTCGCGCAGCGCCTGCGGGCGATGCCGGAGGCCGACCGCCGG
CGCGCCCTGCTCGACCTGGTGCGCACCCACGCGGCGGTCGTGCTGGCCGAGTCCACGCCC
GAGTCCATCGACCCGGGCCAGGGCTTCGTCGACCTGGGCTTCGACTCGCTCGCCAACCTC
GAACTCCAGGAACGGCTGCAGGACGCCACCGGCCTCCAGTTGCCCAGCACCTTGGTGTTC
GACTACCCCACCGCAGAGGTGCTGGCCGACCACCTCTGCGCCGAGTTCGACACCGGGGAG
ACCACGGCGGTGGGCCCCGCGCTCGCCGAACTCGACCGACTGGAGCAGTTCCTGACGCCC
TACACCGACGACGACCAGGCCCGGACGGCGATCACCCACCGGCTGAAGGACCTCCTCGCC
CGCTGGGGGGACGACGGCCGGGACGGCACCGACCGGCCCGACCTCGCCTCGGCCACCGAC
GACGAACTCTTCGACGTACTCGACCAGTTGCGCGCCCGCTGA
[4] KR249..428
[4] ACP539..613
[4] KR745..1284
[4] ACP1615..1839

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [540-615]  1.2e-17 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [539-613]  19.454 PS50075
PS50075   ACP_DOMAIN
 [534-620]  2.7e-19 SSF47336
SSF47336   ACP-like
 [547-612]  2.9e-10 PF00550
PF00550   PP-binding
IPR013968 Polyketide synthase, KR (Domain)
 [249-427]  3.1e-68 PF08659
PF08659   KR
IPR016040 NAD(P)-binding domain (Domain)
 [249-427]  5.5e-35 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [544-616]  6.6e-25 SM00823
SM00823   Phosphopantetheine attachment site
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [249-428]  1.6e-60 SM00822
SM00822   no description
SignalP No significant hit
TMHMM No significant hit