close all open/close all

CDS information : Pier_00050


close this sectionLocation

Organism
Strain
Entry namePiericidin
Contig
Start / Stop / Direction24,302 / 30,808 / + [in whole cluster]
24,302 / 30,808 / + [in contig]
Location24302..30808 [in whole cluster]
24302..30808 [in contig]
TypeCDS
Length6,507 bp (2,168 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)PieA4
GenepieA4
Gene (GenBank)
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • PKS
Reference
ACC
PmId
[22365607] Elucidation of Piericidin A1 biosynthetic locus revealed a thioesterase-dependent mechanism of alpha-pyridone ring formation. (Chem Biol. , 2012)

close this sectionPKS/NRPS Module

5 methylmalonyl-CoA
KS34..410
AT562..877
DH924..1088
ER1411..1715
KR1725..1905
ACP2010..2080

close this sectionSequence

selected fasta
>polyketide synthase [PieA4]
MAQEDKLREHLRWAAAELGEARRRVAELEAADRDPIAIVGMSCRYPGGVRTPEDLWDLVA
AGRDAVGEPPAGRGWRVEDFYDPDALRPGTSYVCEGGFLDDADRFDPAFFGISPREALAM
DPQQRLLLETAWEAFERAGIRPATVRGARVGVFTGLMYHDYGTRLGPVDESVAGFLGSGT
AGSVASGRIAYVLGLEGPAVTVDTACSSSLVALHLAAQAIRRGDCTMALAGGVTVMATPS
TFVEFSRQGGLARDGRCKSFAAAADGTAWGEGAGMLLVERLSDAERNGHRVLAVLRGSSV
NQDGASSNLSAPNGPSQQRVIRQALAEAELSPDLIDAVEAHGTGTKLGDPIEAQALLATY
GQERPAERPLWLGSLKSNLGHTQAAAGVGGVIKMVMAMRNGVLPRTLHVDEPTPHVDWTA
GAVALLTEAQEWPQTGRPRRTAVSSFGVSGTNAHVVLEQAPEVPAAGPGTADGGVLPWVL
SARDERALREQAGQLRAAVEAHPEWEPAAVAGALVSGRSVFEQRAVVIGENRAELLSGLA
ALADGTAAPGVVQGSGTFDRPVFVFPGQGSQWIGMGAELLDTSPVFAQWIAKCEAALAPH
VDWSLTDVLRGKDELTRVDVVQPALFAVMVSLAELWRSLGIEPAAVIGHSQGEIAAATVA
GALSLEDGARVAALRSQAILAISGRGGMASLPLSQDDAAELLKQWNGRLTVAAHNGPTAT
VVAGDRDALDELLNHCEQQEIRARRIDVDYASHSPHVEAIQTQLAQKLTGIAPREATVPF
YSTVTGGLIDTTTLDADYWYTNLRQTVRFTDATHAAHTDGHHAFIEASPHPVLTTSVQDV
TEDAGRQALVTGSLRRDEGGLRRLLTSLAEAHVHGATVTWPTTEPLPTAQLDLPTYPFQR
ERFWLDAPAVAGDVTAAGLTPAEHPLLSALLPLADGDEIILTGQISLTTHPWLADHAVFG
TVLLPGTALVELALRAGDHAGCDVLDELTLQAPLLLPDEGTLQLQLRIGPPEEDGRRAFS
LHSRPDRPDRPDAPWSRHATGVLAVGAERPAWDLAVWPPAGAVPVDVAGLYPRLAEDGLG
YGPAFQGLCALWRRGDDLFAEVRLPAEQHEDAARFGLHPALLDAALHATAAASPGEVRLP
FSWSGVALHATGATALRVRVSPAGADGIALQVADASGAPVAGVATLASRPVDRERLQAAR
EDGADPLLRVEWTELPAPAEAAAGRWVLLGTDRLGLTEGLRIGGHPDLAALAEAVAAGAT
VPDAVLVTCTGAESPDVPSAVRDLTADTLTLLQQWLSAEHFSTSRLVVLTSGAVPAGSGE
GVRDLVAAPLWGLLRSAQTEHPGRFVLIDLDDRHSPAPQDALAAALATDEPQLALRDGRL
YAPRLVRGATGRLLEPPADGAGWRLDTTAKGTLENLALIPYPAAGAPLGPGQVRVAVRAA
GMNFRDVLLGLGMVDQDVMGGEAAGVVLETAPDVTGFAPGDRVMGMVPGSFGPVAVVDHR
LLVPLPAHWTFTEGASVPIAFLTAYYGLVDLARLAPGESVLIHSATGGVGMAAIQLARHL
GAEVFTTASPAKWDTLRSLGVPEDRIASSRDLDFEQRIRAATGGRGVDVVLNSLANEFVD
ASLRLLADGGRFAEMGKTDIRDAAEVTAAHPGTSYLWFDLIEAGYDRIGRMTAELMPLFE
RGTLHPIPARTWDVRRAPDAFRFMSQARHTGKVVLTMPSGPDPDGTVLVTGGTGVLGGLV
ARRLVAEHGVRHLLLLGRRGPEAAGAAELTAELTALGARVTVTACDTADRDALARVLAAV
PAEHPLTGVVHAAGVLDDAVIASLTPAQVAAVLRPKVDAAWHLHELTRDADLGSFVLFSS
SAAVLGGPGQGNYAAANAFLDGLAQHRRAAGLPGLSIAWGLWEQASGMTGHLDDADLTRL
RRSGVRPLSDADGLAMFDSALDADEALLVAMRLDVATARTALQSSSVPPLLRRLIGSPAR
RAVAVAEPGGADAPARRLAALPEAERARALLELVRTNAAVVLGHATDDAIRPDLAFKQLG
FDSLTAVELRNRLGAATGLRLPATLVFDHPRPDALAAYLLAELAPAAPAEPDGPAGAAGA
AASDGEVSRLLATIAPARLRAAGLLDALLALAGAAPEEPPAEADDQLDEIDAMDADDLIG
LALGTTDL
selected fasta
>polyketide synthase [PieA4]
GTGGCACAAGAAGACAAGCTTCGCGAGCACCTCCGGTGGGCTGCCGCCGAGCTCGGCGAG
GCTCGCCGCAGGGTGGCCGAACTGGAGGCGGCCGACCGCGACCCGATCGCGATCGTCGGA
ATGAGCTGCCGGTACCCGGGCGGGGTGCGGACGCCGGAGGACCTGTGGGACCTGGTGGCC
GCCGGGCGGGACGCCGTCGGCGAACCGCCCGCCGGGCGCGGCTGGCGGGTGGAGGACTTC
TACGACCCCGACGCCCTGCGCCCCGGCACGTCCTACGTGTGCGAGGGCGGCTTCCTCGAC
GACGCGGACCGGTTCGACCCCGCGTTCTTCGGCATCAGCCCGCGCGAGGCCCTGGCGATG
GACCCGCAGCAGCGGCTGCTGCTGGAGACCGCGTGGGAGGCCTTCGAGCGGGCGGGCATC
CGGCCGGCGACCGTGCGCGGGGCCCGGGTCGGCGTGTTCACCGGGCTGATGTACCACGAC
TACGGCACCCGCCTCGGCCCGGTGGACGAGTCGGTCGCGGGCTTCCTGGGGAGCGGGACG
GCGGGCAGCGTCGCCTCCGGCCGGATCGCCTACGTCCTCGGCCTGGAGGGGCCGGCGGTG
ACGGTGGACACGGCGTGCTCCTCGTCGCTGGTCGCCCTGCACCTGGCGGCACAGGCGATC
CGTCGCGGCGACTGCACGATGGCGCTGGCCGGCGGCGTCACGGTGATGGCCACCCCGAGC
ACCTTCGTCGAGTTCAGCCGCCAGGGCGGCCTCGCCCGGGACGGGCGCTGCAAGTCCTTC
GCCGCCGCCGCCGACGGGACGGCGTGGGGCGAGGGCGCCGGAATGCTGCTGGTCGAGCGC
CTGTCGGACGCCGAGCGCAACGGGCACCGGGTGCTGGCGGTCCTGCGCGGGTCGTCGGTC
AACCAGGACGGCGCGAGCAGCAACCTCTCCGCGCCCAACGGGCCCTCGCAGCAGCGGGTG
ATCCGCCAGGCCCTCGCCGAGGCCGAACTCTCGCCCGACCTGATCGACGCCGTCGAGGCG
CACGGCACGGGCACCAAGCTCGGCGACCCGATCGAGGCCCAGGCCCTGCTGGCCACCTAC
GGGCAGGAGCGGCCGGCCGAACGGCCGCTCTGGCTGGGGTCGTTGAAGTCCAACCTCGGC
CACACCCAGGCCGCGGCCGGGGTCGGCGGCGTGATCAAGATGGTCATGGCGATGCGCAAC
GGCGTGCTGCCGCGGACCCTGCACGTCGACGAGCCGACGCCGCACGTGGACTGGACCGCC
GGGGCGGTCGCGCTGCTCACCGAGGCGCAGGAGTGGCCGCAGACCGGGCGCCCGCGACGG
ACGGCCGTGTCCTCGTTCGGCGTGAGCGGGACCAACGCGCACGTGGTCCTGGAGCAGGCA
CCGGAGGTGCCGGCGGCCGGCCCGGGCACAGCGGACGGCGGCGTGCTGCCGTGGGTGCTG
TCGGCGCGGGACGAGCGGGCGTTGCGTGAGCAGGCCGGGCAGCTGCGGGCGGCCGTCGAG
GCCCACCCGGAGTGGGAACCGGCCGCAGTGGCCGGGGCGTTGGTGTCGGGCCGGTCCGTG
TTCGAGCAGCGGGCCGTGGTGATCGGAGAGAACCGCGCCGAGCTGCTGAGCGGCCTGGCC
GCCCTCGCCGACGGCACCGCCGCCCCCGGCGTCGTCCAGGGCAGCGGCACCTTCGACCGG
CCGGTGTTCGTCTTCCCCGGCCAGGGCTCCCAGTGGATCGGCATGGGCGCCGAACTCCTC
GACACCTCCCCGGTGTTTGCCCAGTGGATCGCCAAGTGCGAAGCAGCGCTGGCCCCGCAC
GTCGACTGGTCACTGACCGACGTCCTGCGCGGCAAGGACGAGCTGACCAGGGTGGATGTC
GTGCAGCCCGCGCTGTTCGCCGTCATGGTCTCGCTCGCCGAACTCTGGCGTTCGCTCGGG
ATCGAGCCCGCCGCCGTCATCGGCCACTCCCAGGGCGAGATCGCCGCCGCCACCGTCGCG
GGAGCACTCTCGTTGGAGGACGGCGCACGCGTCGCCGCCCTACGCAGCCAGGCCATCCTC
GCCATCAGCGGACGCGGCGGCATGGCCTCCCTCCCGCTGTCCCAGGACGACGCGGCCGAG
CTGCTCAAGCAGTGGAACGGCCGACTCACCGTCGCCGCCCACAACGGCCCCACCGCCACC
GTCGTCGCCGGCGACCGCGACGCCCTCGACGAGCTCCTCAACCACTGCGAGCAGCAGGAG
ATCCGCGCCCGCCGCATCGACGTCGACTACGCCTCCCACTCCCCCCACGTCGAAGCCATC
CAGACCCAACTCGCCCAGAAGCTGACCGGCATCGCACCGCGCGAAGCCACCGTCCCCTTC
TACTCCACGGTCACCGGCGGTCTGATCGACACCACGACCCTCGACGCCGACTACTGGTAC
ACCAACCTCCGCCAGACCGTCCGCTTCACCGACGCCACCCACGCCGCCCACACCGACGGC
CACCACGCCTTCATCGAGGCCAGCCCCCACCCCGTCCTCACCACGTCCGTGCAGGACGTC
ACCGAGGACGCCGGCCGGCAGGCGCTGGTCACCGGTTCGCTGCGCCGTGACGAGGGCGGC
CTCCGCCGGCTGCTCACCTCCCTCGCCGAGGCCCACGTCCACGGCGCCACCGTCACGTGG
CCGACCACGGAGCCCCTCCCCACCGCCCAGCTCGACCTGCCCACCTACCCCTTCCAGCGC
GAACGCTTCTGGCTGGACGCCCCGGCCGTGGCCGGAGACGTCACCGCCGCCGGCCTCACC
CCCGCCGAACACCCCCTGCTCAGCGCACTGCTCCCCCTCGCCGACGGCGACGAGATCATC
CTCACCGGCCAGATCTCCCTCACCACCCACCCCTGGCTCGCCGACCACGCCGTCTTCGGT
ACCGTCCTCCTGCCCGGCACCGCGCTCGTCGAGCTCGCCCTCCGGGCCGGTGACCACGCC
GGCTGCGACGTCCTCGACGAGCTGACGCTCCAGGCACCGCTCCTGCTCCCCGACGAGGGC
ACCCTCCAGCTCCAGCTCCGGATCGGCCCGCCGGAGGAGGACGGCCGCCGCGCCTTCTCG
CTGCACTCCCGCCCCGACCGCCCCGACCGCCCCGATGCCCCCTGGTCCCGGCACGCCACC
GGCGTGCTGGCCGTCGGCGCCGAGCGCCCGGCCTGGGACCTCGCCGTCTGGCCGCCGGCT
GGCGCGGTGCCGGTGGACGTCGCCGGGCTCTACCCCCGGCTGGCCGAGGACGGCCTCGGC
TACGGTCCGGCGTTCCAGGGGCTGTGCGCGCTCTGGCGTCGGGGCGACGACCTGTTCGCC
GAGGTGCGGTTGCCGGCCGAGCAGCATGAGGACGCCGCGCGCTTCGGCCTGCACCCCGCG
CTGCTGGACGCGGCCCTGCACGCGACCGCCGCCGCCTCGCCCGGCGAGGTGCGGCTGCCG
TTCTCGTGGAGCGGTGTCGCCCTGCACGCCACGGGTGCGACTGCGCTGCGCGTGCGGGTC
TCCCCGGCCGGTGCGGACGGGATCGCCCTCCAGGTGGCCGACGCGTCCGGCGCCCCGGTG
GCCGGGGTGGCGACGCTGGCGAGCCGCCCGGTGGACCGGGAGCGGCTGCAGGCGGCGCGC
GAGGACGGCGCGGACCCGCTGCTGCGGGTGGAGTGGACGGAGCTCCCGGCCCCCGCCGAG
GCGGCCGCCGGGCGCTGGGTCCTGCTCGGCACCGACCGGCTGGGCCTGACCGAGGGCCTG
CGGATCGGCGGCCACCCCGACCTGGCCGCTCTGGCCGAGGCCGTCGCTGCGGGTGCGACC
GTTCCCGACGCCGTGCTGGTCACGTGCACCGGCGCCGAGTCGCCGGACGTCCCCTCCGCC
GTCCGCGACCTCACCGCCGACACTCTGACGCTGCTTCAGCAGTGGTTGTCTGCCGAGCAT
TTCAGCACCTCCCGGCTGGTCGTCCTGACCTCGGGCGCCGTCCCGGCCGGCAGCGGCGAG
GGCGTGCGCGACCTGGTCGCCGCTCCGCTCTGGGGCCTGCTGCGCTCCGCCCAGACCGAG
CACCCGGGCCGTTTCGTCCTGATCGACCTCGACGACCGGCACTCCCCCGCCCCGCAGGAC
GCGCTCGCCGCCGCCCTCGCCACCGACGAGCCGCAACTCGCGCTCCGTGACGGCAGGTTG
TATGCCCCTCGGCTGGTCCGCGGCGCCACCGGCCGGCTGCTGGAGCCGCCGGCGGACGGC
GCCGGCTGGCGGCTGGACACCACCGCCAAGGGCACCCTGGAGAACCTCGCCCTGATCCCG
TACCCCGCGGCCGGCGCGCCGCTCGGCCCGGGTCAGGTCCGGGTGGCCGTACGCGCCGCC
GGGATGAACTTCCGCGACGTGCTGCTCGGCCTGGGCATGGTCGACCAGGACGTGATGGGC
GGCGAGGCGGCCGGCGTCGTCCTGGAGACCGCCCCCGACGTGACCGGGTTCGCCCCGGGC
GACCGCGTGATGGGCATGGTGCCCGGCTCGTTCGGGCCGGTCGCCGTGGTCGACCACCGG
CTGCTCGTCCCGCTGCCCGCGCACTGGACGTTCACCGAGGGCGCCTCGGTGCCGATCGCC
TTCCTCACCGCCTACTACGGCCTGGTGGACCTCGCCCGGCTCGCCCCCGGCGAGTCGGTG
CTGATCCACTCGGCGACCGGCGGCGTGGGCATGGCCGCGATCCAACTCGCCCGCCACCTG
GGCGCCGAGGTGTTCACCACGGCGAGCCCGGCCAAGTGGGACACCCTGCGCTCACTGGGT
GTCCCGGAGGACCGGATCGCCTCCTCCCGCGACCTCGACTTCGAGCAGCGGATCCGCGCC
GCCACCGGCGGCCGGGGCGTGGACGTGGTCCTGAACTCGCTCGCCAACGAGTTCGTCGAC
GCATCGCTGCGGCTGCTCGCGGACGGCGGCCGGTTCGCCGAGATGGGCAAGACCGACATC
CGCGACGCGGCCGAGGTCACCGCCGCCCACCCCGGCACCTCCTACCTCTGGTTCGACCTG
ATCGAGGCCGGCTACGACCGGATCGGCCGGATGACGGCCGAGCTGATGCCGCTGTTCGAG
CGCGGCACGCTCCACCCGATCCCCGCCCGCACCTGGGACGTGCGGCGCGCACCGGACGCG
TTCCGCTTCATGAGCCAGGCCCGCCACACCGGCAAGGTGGTGCTCACGATGCCTTCCGGG
CCGGACCCGGACGGCACCGTGCTGGTCACCGGCGGCACGGGCGTGCTGGGCGGCCTGGTC
GCCCGCCGCCTGGTCGCCGAGCACGGCGTGCGGCACCTGCTGCTGCTCGGCCGGCGCGGC
CCGGAGGCTGCGGGCGCGGCCGAGCTGACCGCCGAACTCACCGCCCTGGGCGCCCGGGTG
ACGGTCACCGCCTGCGACACGGCCGACCGCGACGCCCTGGCACGGGTGCTCGCCGCCGTC
CCGGCCGAGCACCCGCTCACCGGCGTCGTCCACGCCGCCGGCGTGCTGGACGACGCGGTG
ATCGCCTCGCTGACCCCCGCCCAGGTGGCGGCGGTGCTCCGCCCGAAGGTGGACGCCGCC
TGGCACCTGCACGAGCTGACCCGGGACGCCGACCTCGGCTCCTTCGTCCTCTTCTCCTCC
TCGGCCGCCGTCCTGGGCGGCCCCGGCCAGGGCAACTACGCGGCGGCCAACGCCTTCCTC
GACGGCCTCGCCCAGCACCGCCGCGCCGCGGGGCTGCCCGGCCTGTCGATCGCCTGGGGC
CTGTGGGAGCAGGCCAGCGGGATGACCGGCCACCTCGACGACGCCGACCTGACCCGGCTG
CGCCGCTCCGGCGTCCGCCCGCTCTCCGACGCCGACGGCCTGGCGATGTTCGACTCGGCC
CTGGACGCCGACGAGGCCCTGCTGGTGGCCATGAGGCTCGACGTCGCGACCGCCCGCACC
GCCCTCCAGTCCTCGTCGGTGCCGCCGCTGCTGCGCCGGCTGATCGGCTCGCCGGCCCGC
CGCGCGGTGGCGGTCGCCGAGCCCGGCGGAGCGGACGCGCCGGCCCGCCGGCTGGCCGCC
CTGCCCGAGGCCGAACGGGCGCGCGCCCTGCTGGAGTTGGTGCGCACCAACGCGGCCGTC
GTACTCGGTCACGCCACCGACGACGCGATCCGGCCGGACCTCGCGTTCAAGCAGCTCGGC
TTCGACTCGCTGACCGCCGTCGAGCTGCGCAACCGGCTGGGCGCCGCCACCGGGCTCCGG
CTCCCGGCGACGCTGGTCTTCGACCACCCGCGGCCGGACGCACTGGCCGCGTACCTGCTC
GCCGAACTGGCCCCGGCCGCACCGGCCGAGCCGGACGGCCCGGCGGGTGCGGCCGGTGCG
GCCGCCTCCGACGGCGAGGTCAGCCGGCTCCTGGCCACCATCGCGCCGGCCCGGCTGCGC
GCCGCCGGCCTGCTCGACGCGCTGCTCGCCCTGGCCGGCGCGGCGCCCGAGGAGCCGCCG
GCCGAGGCGGACGACCAACTGGACGAGATCGACGCCATGGACGCCGACGACCTGATCGGC
CTGGCCCTCGGCACCACTGACCTCTGA
[5] KS34..410
[5] AT562..877
[5] methylmalonyl-CoA750..754
[5] DH924..1088
[5] ER1411..1715
[5] KR1725..1905
[5] ACP2010..2080
[5] KS100..1230
[5] AT1684..2631
[5] methylmalonyl-CoA2248..2262
[5] DH2770..3264
[5] ER4231..5145
[5] KR5173..5715
[5] ACP6028..6240

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [749-867]  1.9e-77 G3DSA:3.40.366.10
G3DSA:3.40.366.10   no description
IPR006162 Phosphopantetheine attachment site (PTM)
 [2038-2053]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [2008-2084]  2.1e-20 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [2002-2097]  2.2e-23 SSF47336
SSF47336   ACP-like
 [2010-2080]  18.975 PS50075
PS50075   ACP_DOMAIN
 [2014-2079]  1e-10 PF00550
PF00550   PP-binding
IPR011032 GroES-like (Domain)
 [1427-1555]  1e-29 SSF50129
SSF50129   GroES-like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [1548-1641]  1e-21 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [1430-1485]  3e-05 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1725-1904]  2e-66 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-284]  2.4e-97 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-410]  2.3e-45 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [562-877]  9.8e-114 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  1.6e-08 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [560-859]  4.8e-70 SSF52151
SSF52151   FabD/lysophospholipase-like
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [684-749]  4.4e-19 SSF55048
SSF55048   Probable ACP-binding domain of malonyl-CoA ACP transacylase
IPR016038 Thiolase-like, subgroup (Domain)
 [34-294]  3.3e-88 G3DSA:3.40.47.10 [296-462]  1.1e-61 G3DSA:3.40.47.10
G3DSA:3.40.47.10   no description
IPR016039 Thiolase-like (Domain)
 [26-462]  4.6e-105 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1501-1691]  2.2e-52 G3DSA:3.40.50.720 [1725-1905]  7.8e-37 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [197-213]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [564-858]  1.4e-128 SM00827
SM00827   Acyl transferase domain in polyketide syntha
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [2011-2083]  2.4e-31 SM00823
SM00823   Phosphopantetheine attachment site
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [924-1088]  1.8e-83 SM00826
SM00826   no description
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-462]  1.1e-223 SM00825
SM00825   Beta-ketoacyl synthase
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1725-1905]  1e-59 SM00822
SM00822   no description
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [1411-1715]  6.3e-191 SM00829
SM00829   Enoylreductase
SignalP No significant hit
TMHMM No significant hit