close all open/close all

CDS information : Pier_00070


close this sectionLocation

Organism
Strain
Entry namePiericidin
Contig
Start / Stop / Direction36,391 / 43,626 / + [in whole cluster]
36,391 / 43,626 / + [in contig]
Location36391..43626 [in whole cluster]
36391..43626 [in contig]
TypeCDS
Length7,236 bp (2,411 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)PieA6
Gene
Gene (GenBank)pieA6
EC number
Keyword
Note
Note (GenBank)
  • PKS
Reference
ACC
PmId
[22365607] Elucidation of Piericidin A1 biosynthetic locus revealed a thioesterase-dependent mechanism of alpha-pyridone ring formation. (Chem Biol. , 2012)

close this sectionPKS/NRPS Module

7 methylmalonyl-CoA
8 malonyl-CoA
KS91..467
AT617..928
ACP989..1065
KS1089..1465
AT1650..1974
ACP2054..2124
TE2195..2405

close this sectionSequence

selected fasta
>polyketide synthase [PieA6]
MNPRRPDWSWTRPRTTRSSTSSPTNSASPDRPTLTRPPATVPASRTCPSRRGCATVASET
EDKLRYFLKRVTADLQETRRRLQEMENVAGEPIAIVGMACRFPGGADSAEQLWQLVADGR
DAISAFPEDRGWDVEALYDPDPDRAGHTYAREGGFVEGADRFDAGFFGIGPREALAMDPQ
QRLLLETSWEAFERAGVDPATLRGSRTGVFMGAGQVDYAALAQNATESLEGYLLSGGAAS
VISGRLSYVFGLEGPAITVDTACSSSLVALHLACQSLRRGECTTALAGGAAVMAAPGMFV
EFSRQRGLAPDGRCKAFAASADGTGWGEGVGVLLLERLSDAQRNGHRVLAVVRGSAVNQD
GASNGLTAPNGPAQQRVIWDALDNARLSAAEVDAVEAHGTGTTLGDPIEAQALLATYGQD
RSAEQPLWLGSVKSNIGHTQAAAGVAGVIKMVMAMRNGVLPRTLHVDEPTPHVDWSAGAV
SLLTEAQEWPAGEQARRAGISGFGASGTNAHVILEEAPEEPQRETAESNSPSSVVPWVLS
ARDERALRAQAGQLATFLQDHPDTDLRAVGHTLLTGRAALDHRAVALGQNHDELLTTLTA
LADGTAPIGHGTHDRPVFVFPGQGSQWIGMGAELLDTSPVFAQWIANCEAALAPHVDWSL
TEVLRGKDELTRVDVVQPALFAVMVSLAELWRSLGIEPAAVIGHSQGEIAAATVAGALSL
EDGARVAALRSQAILAISGHGGMASLPLSAEDATALLARWDGRLTVAAHNGPTTTVIAGD
RDALDELLNHCEQQEIRARRIDVDYASHSPHVEAIQADLATQLAGVTPQAASVPFYSTVT
GGLIDTRQLDAAYWYTNLRQTVRFTDATHAAHTDGHTTYIEASPHPVLTPAIEETLDTET
VIVTGTLRRNEDTWTRLLTSATHLHNHGHPLNWTPFLHPATHPDLPTYPFQQRRYWVDTT
GTGRPFTESEDRATGSAAAELRRRLAELSEPDRERLVRDLVDSHAIAVLDLASPITPGRT
FQELGFVSLTAVELRNRLMAATGLRLPAAVAFDHPTPEALSRHLLAQLSDTDVEIADAEP
APAAAVGTDEPIAVVAMACRYPGEVRSPEELWQLVAESRDAITPFPDNRGWDLDNLYDPD
PDRAGRSYTREGGFLHDADRFDAAFFGIGPREALAMDPQQRLLLETSWEAFERAGIDPTT
LRGSRTGVFAGSSGQDYHLLAQGSPDGLEGYLLTGNAASVLSGRLAYTFGLEGPAATVDT
ACSSSLVALHLACQSLRSGESTLALAGAVSVLSTPQAFVAFSRQRGLAPDGRCKPFAAAA
DGTAWGEGVGVLLLERLSDARRNGHPVLAVVRGSATNQDGASNGLSAPNGPSQQRVIRQA
LANARLTPDEVDAVEAHGTGTPLGDPIEAEALLATYGRGRPAEQPLYLGSVKSNIGHTAA
AAGMAGVIKMVMAMRHGVLPPMLHTDAPTPHVDWAAGSVALLTEPVAWPERDRPRRAGVS
AFGISGTNAHVVLEQAPPLPARPAPSHASEDSNGSSGTDGAAARDRAAAADPAGPTPSAG
PLLPWLVSARGEAALRAQAERLREHLAGSPAVDPAAVGRSLALSRAALPHRAVLLGRDAA
ELGTALDALAAGTPAPGLVRGTVAAGRVGFLFPGQGSQRPGMGQGLYAAHPVFARTLDEV
CALLDQHLAPLGHPALRDVLFAPEGSPGAALLDETVFTQAGLFAVGLAAFRLLESWGVRP
DWVGGHSIGELTAACAAGVFSVEDACRLVAARGRLMQDSPAGAMVAVEAAEEDVLPLLAG
REDRLGIAAVNGPRATVLSGLAEAVDEAAAELAGRGCRTRRLRVARAFHSPLMDGVLERF
HEAASGLDYRPPRIRLLSNLTGEPATAEQVGRPEYWVRHIREAVRFHDGLRRMAEDGVTA
FLELGPGGVLSGLVRDGLAERTPAPAAVPLLRRARPEAESALTALAHVHVRGVPVDWAAV
LAGGGTPHLDPYVVDLPTYAFQRRRFWIEGAAALPRPAGGGALAAAEPVADTESPDRLRD
RLLALDAPERLATLRDLVAAQVAAALGHASADELETGLDLPELGLDSLAATELSAALQAA
TGVPLPSTAVFEHPTLDGLAAHLEAGLGAAAAPPDGSAAGLLASLAPRAAELGRFAEFGE
LLAAAARFRDTFDGPPDGGGRPAPVRLARGTAGPRFFCFPSFASRSGAHQYARLAAAFDG
RHELWALPAPGFAAGERLPADLDALVRLHAEDVERLAADEPFVLLGHSAGGWIAHAVATY
LEKLGTAPVSVVLLDSYRPGSAILPRIQAEIAKLLTGGQLPADQLLDDTCLTAMGGYARL
FESWQPQPLATPTLQLRAARPLPGFPATGWQASWPVPHTEDEVPGDHFSLTGEHSTSTVR
AVLDRLAEPSA
selected fasta
>polyketide synthase [PieA6]
GTGAATCCCCGGCGGCCGGACTGGAGTTGGACTCGGCCGAGGACGACGAGGTCTTCGACT
TCATCACCAACGAACTCGGCATCTCCTGACCGCCCCACCCTGACCCGCCCGCCGGCGACC
GTGCCGGCATCCCGTACCTGTCCATCCCGAAGGGGTTGCGCCACTGTGGCCAGCGAGACC
GAGGACAAGCTCCGCTACTTCCTCAAGCGGGTGACCGCCGACCTCCAGGAGACGCGCCGG
CGGCTCCAGGAGATGGAGAACGTCGCGGGCGAGCCGATCGCGATCGTCGGCATGGCCTGC
CGCTTCCCCGGCGGTGCCGACTCGGCGGAGCAGCTCTGGCAGTTGGTCGCGGACGGCCGG
GACGCGATCTCCGCATTCCCGGAGGACCGCGGCTGGGACGTCGAGGCGCTGTACGACCCC
GACCCGGACCGCGCCGGCCACACCTACGCCCGCGAGGGCGGATTCGTCGAGGGAGCGGAC
CGGTTCGACGCCGGTTTCTTCGGCATCGGCCCGCGTGAGGCCCTGGCGATGGACCCGCAG
CAGCGGCTGCTGCTGGAGACCTCCTGGGAGGCCTTCGAACGGGCCGGCGTCGACCCGGCC
ACACTGCGGGGCAGCAGGACCGGCGTCTTCATGGGCGCCGGGCAGGTCGACTACGCGGCA
CTCGCCCAGAACGCGACCGAGAGCCTGGAGGGGTACCTGCTCTCCGGCGGGGCGGCGAGC
GTGATCTCGGGCCGGCTCTCCTACGTGTTCGGGCTGGAGGGCCCGGCGATCACGGTCGAC
ACGGCGTGCTCGTCGTCCTTGGTGGCCCTGCACCTGGCCTGCCAGTCGCTGCGCCGGGGC
GAGTGCACGACCGCCCTCGCCGGCGGGGCGGCGGTGATGGCCGCGCCGGGCATGTTCGTC
GAGTTCAGCCGCCAGCGCGGGCTCGCCCCCGACGGCCGCTGCAAGGCCTTCGCCGCCTCG
GCGGACGGCACCGGCTGGGGCGAGGGCGTCGGCGTCCTGCTGCTGGAGCGGCTGTCCGAC
GCGCAGCGCAACGGGCACCGGGTGCTGGCGGTCGTGCGCGGCTCGGCCGTCAACCAGGAC
GGCGCCAGCAACGGGCTCACCGCGCCCAACGGGCCGGCGCAGCAGAGGGTGATCTGGGAC
GCGCTCGACAACGCCCGCCTCTCGGCGGCCGAGGTGGACGCGGTCGAGGCCCACGGCACC
GGCACGACGCTGGGCGACCCGATCGAGGCCCAGGCCCTGCTGGCCACCTACGGCCAGGAC
CGATCGGCCGAACAGCCGCTCTGGCTGGGGTCGGTGAAGTCCAACATCGGCCACACCCAG
GCCGCGGCGGGCGTCGCCGGGGTCATCAAGATGGTCATGGCGATGCGCAACGGCGTGCTG
CCGCGCACCCTGCACGTCGACGAGCCGACTCCGCATGTCGACTGGTCGGCCGGGGCCGTC
TCGCTGCTCACCGAGGCGCAGGAGTGGCCGGCCGGCGAGCAGGCCCGGCGGGCCGGGATC
TCGGGCTTCGGGGCGAGCGGGACGAACGCGCATGTGATCCTGGAGGAGGCGCCGGAGGAG
CCGCAGCGGGAGACGGCCGAGAGCAACTCGCCGTCGTCGGTGGTGCCGTGGGTGCTCTCC
GCCCGTGATGAACGCGCCCTGCGCGCCCAGGCCGGACAGCTCGCCACCTTCCTGCAGGAC
CACCCCGACACCGACCTGCGGGCCGTCGGCCACACCCTGCTCACCGGACGTGCCGCCCTC
GACCACCGCGCCGTCGCCCTCGGCCAGAACCACGACGAACTCCTCACCACCCTGACCGCG
CTCGCCGACGGCACCGCCCCCATCGGCCACGGCACCCACGACCGGCCCGTCTTCGTCTTC
CCCGGCCAGGGCTCCCAATGGATCGGCATGGGCGCCGAACTCCTCGACACCTCCCCGGTG
TTCGCCCAGTGGATCGCCAACTGCGAAGCAGCACTCGCCCCGCACGTCGACTGGTCGCTC
ACGGAGGTGCTGCGCGGCAAGGACGAGCTGACCAGGGTGGATGTCGTGCAGCCCGCGCTG
TTCGCCGTCATGGTCTCCCTCGCCGAACTCTGGCGCTCCCTCGGAATCGAGCCCGCCGCC
GTCATCGGCCACTCCCAGGGCGAGATCGCCGCCGCCACCGTCGCCGGAGCACTCTCGTTG
GAGGACGGCGCACGCGTCGCCGCCCTACGCAGCCAGGCCATCCTCGCCATCAGCGGACAC
GGCGGCATGGCCTCCCTCCCCCTCAGCGCTGAGGACGCCACCGCCCTCCTCGCCCGCTGG
GACGGCCGACTCACCGTCGCCGCCCACAACGGCCCCACCACCACCGTCATCGCCGGCGAC
CGCGACGCCCTCGACGAACTCCTCAACCACTGCGAGCAGCAGGAGATCCGCGCCCGCCGC
ATCGACGTCGACTACGCCTCCCACAGCCCCCACGTCGAAGCCATCCAAGCCGACCTGGCC
ACCCAGCTGGCCGGAGTGACGCCTCAGGCAGCGTCCGTGCCGTTCTACTCGACGGTCACC
GGCGGTCTCATCGACACCCGCCAGCTGGACGCTGCTTACTGGTACACCAACCTCCGCCAG
ACCGTCCGCTTCACCGACGCCACCCACGCCGCCCACACCGACGGCCACACCACCTACATC
GAGGCCAGCCCCCACCCCGTCCTCACCCCCGCCATCGAAGAAACCCTCGACACGGAAACC
GTCATCGTCACCGGCACCCTCCGCCGCAACGAAGACACCTGGACCCGCCTCCTCACCTCC
GCCACCCACCTCCACAACCACGGCCACCCCCTCAACTGGACCCCCTTCCTCCACCCTGCC
ACCCACCCCGACCTCCCCACCTACCCCTTCCAGCAACGCCGTTACTGGGTGGACACGACC
GGCACCGGCAGGCCATTCACCGAGTCGGAGGACCGCGCCACGGGCTCTGCCGCAGCGGAG
CTGCGCCGCCGCCTCGCCGAGCTGTCCGAGCCCGACCGCGAGCGGCTGGTGCGCGACCTG
GTGGACTCCCACGCGATCGCCGTCCTCGACCTGGCCTCCCCGATCACGCCGGGTCGGACC
TTCCAGGAGCTGGGCTTCGTCTCGCTCACCGCCGTCGAGCTGCGCAACCGGCTGATGGCC
GCCACCGGCCTCCGGCTCCCGGCCGCCGTCGCCTTCGACCACCCGACGCCCGAGGCCCTG
AGCCGCCACCTGCTCGCCCAACTCTCCGACACGGACGTCGAGATCGCCGACGCCGAGCCC
GCCCCCGCGGCAGCGGTCGGCACCGACGAGCCGATCGCCGTCGTCGCGATGGCCTGCCGC
TACCCGGGCGAGGTCCGCAGCCCCGAGGAGCTGTGGCAGCTGGTCGCGGAGAGCCGGGAC
GCCATCACACCGTTCCCCGACAATCGCGGCTGGGACCTCGACAACCTCTACGACCCCGAC
CCGGACCGCGCGGGCCGGAGCTACACCCGCGAGGGCGGGTTCCTCCACGACGCCGACCGG
TTCGACGCCGCGTTCTTCGGCATCGGCCCGCGCGAGGCGCTGGCCATGGACCCGCAGCAG
CGACTGCTGCTGGAGACCTCCTGGGAGGCCTTCGAGCGCGCCGGCATCGACCCGACCACC
CTGCGCGGCAGCCGGACCGGGGTGTTCGCCGGGAGCAGCGGCCAGGACTACCACCTGCTG
GCGCAGGGCTCGCCGGACGGTCTGGAGGGGTACCTGCTGACCGGCAACGCGGCCAGCGTC
CTGTCCGGCCGACTCGCCTACACCTTCGGGCTGGAGGGGCCGGCCGCCACCGTGGACACG
GCCTGCTCGTCCTCCCTGGTCGCCCTGCACCTGGCCTGCCAGTCGCTGCGCTCGGGCGAG
AGCACGCTCGCGCTCGCGGGCGCCGTCAGCGTGCTCTCCACCCCGCAGGCCTTCGTCGCC
TTCAGCCGGCAGCGGGGGCTGGCTCCGGACGGGCGGTGCAAGCCGTTCGCCGCTGCGGCC
GACGGCACGGCCTGGGGCGAGGGGGTGGGCGTGCTGCTGCTGGAGCGGCTCTCCGACGCC
CGGCGCAACGGGCACCCGGTGCTGGCCGTCGTCCGCGGCTCGGCGACCAACCAGGACGGC
GCCAGCAACGGCCTGTCCGCGCCCAACGGTCCTTCTCAGCAGCGGGTCATCCGGCAGGCG
CTGGCCAACGCCCGGCTGACCCCGGACGAGGTGGACGCGGTGGAGGCGCACGGGACGGGC
ACGCCGCTCGGCGACCCGATCGAGGCCGAGGCGCTGCTGGCCACCTACGGGCGGGGCCGC
CCGGCCGAACAGCCCCTCTACCTCGGCTCGGTGAAGTCCAACATCGGCCACACCGCTGCG
GCCGCCGGGATGGCGGGGGTGATCAAGATGGTGATGGCGATGCGGCACGGCGTCCTGCCG
CCGATGCTGCACACCGACGCCCCCACCCCGCACGTCGACTGGGCCGCGGGATCGGTCGCC
CTCCTCACGGAGCCGGTGGCCTGGCCGGAGCGGGACCGTCCCCGGCGCGCGGGCGTGTCC
GCGTTCGGCATCAGCGGCACCAACGCCCACGTCGTCCTGGAACAGGCCCCGCCGCTGCCT
GCCCGCCCGGCTCCGTCCCACGCTTCCGAAGACTCCAACGGTTCCAGCGGCACCGACGGC
GCCGCAGCGCGCGACCGGGCGGCGGCCGCCGATCCGGCCGGGCCGACGCCGTCGGCCGGT
CCGCTCCTCCCCTGGCTGGTCTCGGCCCGCGGCGAGGCCGCCCTGCGGGCCCAGGCGGAG
CGGCTGCGCGAGCACCTCGCCGGCTCGCCCGCCGTCGACCCGGCCGCCGTCGGGCGTTCG
TTGGCCCTCTCCCGGGCCGCCCTGCCGCACCGGGCGGTGCTGCTCGGGCGCGACGCCGCC
GAGCTGGGCACCGCTCTCGACGCCCTGGCCGCGGGCACCCCCGCGCCCGGGCTGGTCCGC
GGCACGGTGGCCGCGGGCCGGGTCGGCTTCCTCTTCCCCGGCCAGGGCAGCCAGCGCCCG
GGCATGGGCCAGGGCCTGTACGCGGCCCACCCGGTCTTCGCCCGGACCCTGGACGAGGTG
TGCGCGCTGCTGGACCAGCACCTCGCTCCGCTCGGCCACCCCGCCCTGCGCGACGTGCTG
TTCGCCCCCGAGGGCAGCCCCGGGGCCGCCCTGCTCGACGAGACGGTGTTCACCCAGGCC
GGGCTCTTCGCGGTCGGCCTGGCGGCGTTCCGGCTGCTGGAGTCCTGGGGGGTGAGGCCG
GACTGGGTCGGCGGCCACTCGATCGGCGAGCTGACGGCGGCCTGTGCGGCCGGGGTGTTC
TCCGTCGAGGACGCCTGCCGGCTGGTCGCCGCCCGCGGCCGGCTGATGCAGGACTCGCCG
GCCGGCGCCATGGTCGCGGTGGAGGCGGCCGAGGAGGACGTGCTGCCGCTGCTGGCGGGC
CGGGAGGACCGGCTCGGCATCGCCGCCGTCAACGGACCGCGCGCCACCGTGCTCTCCGGC
CTGGCCGAGGCGGTCGACGAGGCCGCCGCCGAGCTGGCCGGGCGCGGCTGCCGGACCAGG
CGGCTGCGGGTCGCCCGGGCGTTCCACTCGCCGCTGATGGACGGCGTGCTGGAGCGCTTC
CACGAGGCAGCGAGCGGGCTCGACTACCGGCCGCCGCGGATCCGGCTGCTCTCGAACCTG
ACCGGCGAGCCGGCGACCGCCGAGCAGGTGGGCCGACCGGAGTACTGGGTGCGGCACATC
CGCGAGGCGGTCCGCTTCCACGACGGCCTCCGCCGGATGGCCGAGGACGGCGTCACCGCT
TTCCTCGAACTCGGCCCCGGCGGTGTGCTGTCCGGCCTCGTCCGGGACGGCCTGGCCGAG
CGGACGCCGGCCCCGGCGGCGGTGCCGCTGCTCCGGCGCGCCCGCCCGGAGGCGGAGAGC
GCGCTGACCGCGCTCGCCCACGTCCACGTCCGCGGCGTCCCGGTCGACTGGGCCGCCGTC
CTCGCCGGCGGCGGGACACCGCACCTCGACCCGTACGTCGTCGACCTGCCCACCTACGCG
TTCCAGCGCCGCCGGTTCTGGATCGAGGGCGCCGCCGCGCTCCCCCGGCCGGCCGGGGGC
GGCGCCCTGGCGGCCGCCGAGCCGGTGGCCGATACCGAGTCCCCCGACCGGCTGCGCGAT
CGGCTGCTCGCCCTCGATGCGCCCGAACGCCTCGCCACCCTGCGGGATTTGGTGGCCGCC
CAGGTGGCCGCCGCTCTGGGGCACGCCTCCGCCGACGAGCTGGAGACCGGGCTGGACCTG
CCCGAGCTGGGACTCGACTCGCTCGCGGCGACCGAGCTCAGCGCCGCCCTGCAGGCCGCC
ACCGGCGTCCCGCTCCCCTCCACCGCCGTGTTCGAGCACCCCACGCTGGACGGCCTCGCC
GCGCATCTCGAAGCCGGGCTGGGCGCCGCCGCGGCCCCGCCGGACGGGTCGGCCGCCGGC
CTGCTGGCCTCGCTCGCCCCCCGGGCCGCAGAGCTGGGCCGGTTCGCCGAGTTCGGCGAA
CTCCTCGCGGCCGCCGCCCGGTTCCGGGACACCTTCGACGGCCCGCCGGACGGGGGCGGC
CGTCCGGCGCCGGTCCGCCTCGCCCGGGGCACGGCGGGCCCCCGCTTCTTCTGCTTCCCC
TCCTTCGCCTCCAGGTCCGGCGCCCACCAGTACGCCCGGCTGGCCGCCGCCTTCGACGGC
CGGCACGAGCTCTGGGCGCTGCCCGCACCCGGCTTCGCCGCGGGCGAGCGGCTGCCCGCC
GACCTCGACGCGCTGGTGCGCCTGCACGCCGAGGACGTCGAACGGCTCGCGGCCGACGAG
CCGTTCGTCCTCCTCGGCCACTCGGCCGGCGGCTGGATCGCGCACGCGGTGGCGACGTAC
CTGGAGAAGCTCGGCACCGCACCGGTCTCCGTCGTCCTGCTGGACAGCTACCGGCCCGGG
AGTGCGATACTTCCCCGCATCCAGGCGGAGATCGCCAAGCTTCTGACTGGAGGTCAACTC
CCGGCCGACCAGCTGCTGGACGACACCTGCCTCACCGCGATGGGCGGCTACGCCCGGCTC
TTCGAGAGCTGGCAGCCGCAGCCCCTCGCCACGCCGACGCTCCAGCTCCGCGCGGCCCGG
CCGCTCCCCGGCTTCCCCGCCACGGGCTGGCAGGCCTCCTGGCCGGTGCCGCACACCGAG
GACGAGGTGCCGGGCGACCACTTCTCCCTGACCGGCGAGCACAGCACCTCCACCGTGCGC
GCCGTCCTCGACCGGCTCGCCGAGCCGTCCGCCTGA
[7] KS91..467
[7] AT617..928
[7] methylmalonyl-CoA805..809
[7] ACP989..1065
[8] KS1089..1465
[8] AT1650..1974
[8] malonyl-CoA1846..1850
[8] ACP2054..2124
[8] TE2195..2405
[7] KS271..1401
[7] AT1849..2784
[7] methylmalonyl-CoA2413..2427
[7] ACP2965..3195
[8] KS3265..4395
[8] AT4948..5922
[8] malonyl-CoA5536..5550
[8] ACP6160..6372
[8] TE6583..7215

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [2195-2405]  2.50000000000001e-35 PF00975
PF00975   Thioesterase
IPR001227 Acyl transferase domain (Domain)
 [614-737]  G3DSA:3.40.366.10 [805-920]  G3DSA:3.40.366.10 [1646-1779]  G3DSA:3.40.366.10 [1846-1964]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [2082-2097]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [989-1065]  PS50075 [2054-2124]  PS50075
PS50075   ACP_DOMAIN
 [990-1106]  1e-21 SSF47336 [2047-2144]  6.59999852526375e-20 SSF47336
SSF47336   ACP_like
 [997-1070]  1.29999999999998e-35 G3DSA:1.10.1200.10 [2054-2127]  1.29999999999998e-35 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1008-1064]  8.9e-08 PF00550 [2058-2123]  3e-12 PF00550
PF00550   PP-binding
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [91-341]  2.70000000000002e-101 PF00109 [1089-1340]  3.60000000000002e-99 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [349-467]  8.79999999999995e-49 PF02801 [1348-1465]  1.9e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [617-928]  1.69999999999998e-109 PF00698 [1650-1974]  1.2e-60 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [58-91]  3.89999861795218e-08 SSF101173
SSF101173   Polyketide_synth_docking
 [60-84]  9.40000000000003e-11 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [615-914]  6.19996040581186e-71 SSF52151 [1647-1942]  6.19996040581186e-69 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [739-804]  4.40000933643892e-19 SSF55048 [1780-1845]  9.30000048475975e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [91-352]  G3DSA:3.40.47.10 [353-521]  G3DSA:3.40.47.10 [1092-1352]  G3DSA:3.40.47.10 [1353-1518]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [83-519]  1e-104 SSF53901 [1082-1518]  1.19999063421924e-105 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [254-270]  PS00606 [1253-1269]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [619-911]  SM00827 [1651-1955]  1e-116 SM00827
SM00827   PKS_AT
IPR020802 Polyketide synthase, thioesterase domain (Domain)
 [2197-2406]  1.09999184471405e-91 SM00824
SM00824   PKS_TE
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [998-1068]  4.40000933643891e-24 SM00823 [2055-2127]  1.89999859865865e-23 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [93-519]  SM00825 [1092-1518]  SM00825
SM00825   PKS_KS
SignalP No significant hit
TMHMM No significant hit