close all open/close all

CDS information : Pier_00080


close this sectionLocation

Organism
Strain
Entry namePiericidin
Contig
Start / Stop / Direction43,672 / 44,358 / + [in whole cluster]
43,672 / 44,358 / + [in contig]
Location43672..44358 [in whole cluster]
43672..44358 [in contig]
TypeCDS
Length687 bp (228 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative O-methyltransferase
Product (GenBank)PieB1
GenepieB1
Gene (GenBank)
EC number2.1.1.-
Keyword
Note
Note (GenBank)
  • methyltransferase
Reference
ACC
PmId
[22365607] Elucidation of Piericidin A1 biosynthetic locus revealed a thioesterase-dependent mechanism of alpha-pyridone ring formation. (Chem Biol. , 2012)
Related Reference
ACC
Q70KH3
NITE
Aureo_00090
PmId
[16292785] Dissection of the late steps in aureothin biosynthesis. (Chembiochem. , 2006)
ACC
Q2P9Z9
NITE
Stref_00160
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)
ACC
Q9KHK8
NITE
Enter_00070
PmId
[11893195] Mutational analysis of the enterocin favorskii biosynthetic rearrangement. (Org Lett. , 2002)
[15505225] EncM, a versatile enterocin biosynthetic enzyme involved in Favorskii oxidative rearrangement, aldol condensation, and heterocycle-forming reactions. (Proc Natl Acad Sci U S A. , 2004)
ACC
W0CAB5
PmId
[24409990] Elucidating hydroxylation and methylation steps tailoring piericidin A1 biosynthesis. (Org Lett. , 2014)

close this sectionSequence

selected fasta
>putative O-methyltransferase [PieB1]
MSIDNDHQPGSVDQAVLDGANPYHRRALAFYDLLVFRGSAPLFWRCSPRNFLEMYRTSIG
AKHLEIGVGTGYLLQRTRFPVSNPEITLADLNPSTLDFTAERLAHFKTTKVVANALEPLP
VPAESHDSAALSFLLHCIPGSLREKGVAIRHAAAAVRPGGTVFGSTILSQGVPVTGAGRW
LMNDLNGKGVFHNDQDHLDDLRDQLKQNFDDFDLAVRGCVALWRARKS
selected fasta
>putative O-methyltransferase [PieB1]
ATGAGCATCGACAACGACCACCAGCCCGGCTCCGTCGACCAGGCGGTCCTGGACGGCGCG
AACCCGTACCACCGGCGCGCGCTCGCCTTCTACGACCTGCTCGTCTTCCGCGGCAGCGCA
CCGCTGTTCTGGCGCTGCTCCCCGCGCAACTTCCTGGAGATGTACCGGACCTCCATCGGC
GCCAAGCACCTGGAGATCGGCGTCGGCACCGGCTACCTGCTGCAGCGCACCCGGTTCCCG
GTCTCGAACCCGGAGATCACGCTGGCCGACCTCAACCCCAGCACCCTCGACTTCACCGCC
GAGCGGCTGGCGCACTTCAAGACCACCAAGGTGGTCGCCAACGCGCTGGAGCCGCTGCCG
GTGCCCGCCGAGAGCCACGACTCGGCCGCCCTCAGCTTCCTGCTGCACTGCATCCCCGGC
AGCCTGCGCGAGAAGGGCGTCGCCATCCGGCACGCCGCGGCGGCCGTGCGGCCCGGCGGC
ACGGTGTTCGGCAGCACGATCCTCTCCCAGGGCGTCCCGGTCACCGGGGCCGGCCGCTGG
CTGATGAACGACCTCAACGGCAAGGGTGTCTTCCACAACGACCAGGACCACCTGGACGAC
CTGCGCGACCAGCTGAAGCAGAACTTCGACGACTTCGACCTGGCCGTGCGCGGCTGCGTC
GCCCTGTGGCGGGCCCGCAAGTCGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013217 Methyltransferase type 12 (Domain)
 [64-161]  4.9e-08 PF08242
PF08242   Methyltransf_12
IPR016584 S-adenosyl-L-methionine dependent methyltransferase, YbcY, predicted (Family)
 [1-228]  4.40002866058555e-94 PIRSF011491
PIRSF011491   Mtase_YbcY_prd
SignalP No significant hit
TMHMM No significant hit