close all open/close all

CDS information : Pier_00090


close this sectionLocation

Organism
Strain
Entry namePiericidin
Contig
Start / Stop / Direction44,470 / 44,982 / + [in whole cluster]
44,470 / 44,982 / + [in contig]
Location44470..44982 [in whole cluster]
44470..44982 [in contig]
TypeCDS
Length513 bp (170 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.3 uncharacterized protein (biosynthesis involved)
Producthypothetical protein
Product (GenBank)PieC
GenepieC
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • hypothetical protein
Reference
ACC
PmId
[22365607] Elucidation of Piericidin A1 biosynthetic locus revealed a thioesterase-dependent mechanism of alpha-pyridone ring formation. (Chem Biol. , 2012)

close this sectionSequence

selected fasta
>hypothetical protein [PieC]
MAARWYPIEEADDSLFATAPLYHARSVEVPFTAEETWAALTGDGVSSWTKGMRQLTWTSP
RPFGVGTTREIEMESGLVLREHFFRWEEGTRKTFTATEATKPIFRHLVEDYVVEPTETGA
RFSWRWAAELNRPWSFLQGALDRFFFAPTGRSHIDGLPAYMASQRGTALR
selected fasta
>hypothetical protein [PieC]
ATGGCCGCCCGCTGGTATCCGATCGAGGAAGCCGACGACTCGCTGTTCGCCACCGCCCCG
CTGTACCACGCCCGTTCGGTCGAGGTGCCGTTCACCGCGGAGGAGACCTGGGCGGCCCTG
ACCGGCGACGGCGTCTCCAGCTGGACCAAGGGCATGCGTCAGCTCACCTGGACCTCGCCG
CGGCCGTTCGGTGTCGGCACCACCCGCGAGATCGAGATGGAGAGCGGCCTCGTCCTGCGC
GAGCACTTCTTCCGCTGGGAGGAGGGCACCCGCAAGACCTTCACCGCCACCGAGGCGACC
AAGCCGATCTTCCGCCACCTGGTGGAGGACTACGTGGTCGAGCCCACCGAGACCGGCGCC
CGGTTCAGCTGGCGCTGGGCGGCGGAGCTGAACCGCCCGTGGTCCTTCCTGCAGGGCGCC
CTGGACCGTTTCTTCTTCGCCCCGACCGGCCGCTCGCACATCGACGGCCTGCCCGCCTAC
ATGGCCTCCCAGCGCGGCACCGCGCTCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019587 Polyketide cyclase/dehydrase (Family)
 [25-134]  5.10000000000001e-09 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [25-142]  1.6e-05 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP No significant hit
TMHMM No significant hit