close all open/close all

CDS information : Pier_00100


close this sectionLocation

Organism
Strain
Entry namePiericidin
Contig
Start / Stop / Direction45,028 / 46,869 / + [in whole cluster]
45,028 / 46,869 / + [in contig]
Location45028..46869 [in whole cluster]
45028..46869 [in contig]
TypeCDS
Length1,842 bp (613 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative amide synthetase
Product (GenBank)PieD
GenepieD
Gene (GenBank)
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • asparagine synthase
Reference
ACC
PmId
[22365607] Elucidation of Piericidin A1 biosynthetic locus revealed a thioesterase-dependent mechanism of alpha-pyridone ring formation. (Chem Biol. , 2012)
Related Reference
ACC
Q3S8R1
NITE
Oxtet_00050
PmId
[16597959] Engineered biosynthesis of a novel amidated polyketide, using the malonamyl-specific initiation module from the oxytetracycline polyketide synthase. (Appl Environ Microbiol. , 2006)
[21622525] Genetic characterization of enzymes involved in the priming steps of oxytetracycline biosynthesis in Streptomyces rimosus. (Microbiology. , 2011)
ACC
Q2MGB4
NITE
Fred_00250
PmId
[20926388] Characterization of FdmV as an amide synthetase for fredericamycin A biosynthesis in Streptomyces griseus ATCC 43944. (J Biol Chem. , 2010)

close this sectionSequence

selected fasta
>putative amide synthetase [PieD]
MCGIAGWISFQHDLDRELAALSAMTDTMACRGPDASGTWLSAHAALGHRRLSIIDLAGGV
QPMVAETPDGPVVLTYSGEAYNFTELRAELRRRGHEFRTSSDTEVVLRGYLEWGQGVADR
LNGMYALGIWDGRVEKLVLLRDRLGIKPLYYAPTAGGLVFGSEAKALLAHPEVEPVVDAD
GFRELFGFVKEPGRAVWAGMHEVKPGTMVTFDRSGLREHVYWRLEVAEHRDDTETTVRRV
REMLEDSVARQLVADVPQCVLLSGGLDSSALTALAGRRLAADGERARTFTVDFEQSDAFR
PDDLRGSPDAPFAREVVQHVGTLHHDIKLDYQELANPEVRRATVTARDLPFGFGEADNSL
YLLFKAIREHSTVALSGESSDEIFGGYPWFHLPAVQQVPMFPWVTASGLGPRNHPTKLID
PDLLLRTLDVPGYWAQRWSDTVAALPVVAGEDAHERRMREFCYVHLTSLLGLLLDRKDRM
SMAVGLEVRVPFCDHRLVEYVFNTPWAMKTFDGREKSLLRAAVKDVLPSSVVERVKALYP
HTQQLAYVGRLQQQVGELLSADHEAVTLFDGAALAKAVAAQPEAVDRDEREAFERVLDLA
VWLDLYRPTIKLS
selected fasta
>putative amide synthetase [PieD]
ATGTGCGGGATCGCTGGCTGGATCTCCTTCCAGCACGACCTCGACCGTGAACTCGCCGCC
CTGAGCGCCATGACCGACACCATGGCCTGCCGCGGCCCGGACGCCTCCGGCACCTGGCTG
TCGGCCCACGCCGCCCTCGGCCACCGCCGGCTCTCCATCATCGACCTGGCCGGCGGCGTG
CAGCCCATGGTCGCCGAGACGCCGGACGGCCCGGTCGTGCTGACCTACAGCGGTGAGGCG
TACAACTTCACCGAGCTGCGGGCCGAACTCCGGCGCCGGGGCCACGAGTTCCGTACCTCC
AGCGACACCGAGGTGGTACTGCGCGGCTACCTGGAGTGGGGACAGGGGGTCGCCGACCGG
CTCAACGGCATGTACGCCCTGGGCATCTGGGACGGCCGCGTGGAGAAGCTGGTGCTGCTG
CGCGACCGCCTGGGCATCAAGCCGCTCTACTACGCCCCCACCGCCGGCGGCCTGGTGTTC
GGCTCCGAGGCCAAGGCCCTGCTGGCCCACCCCGAGGTGGAGCCGGTCGTCGACGCCGAC
GGGTTCCGCGAGCTGTTCGGCTTCGTCAAGGAGCCCGGCCGCGCGGTCTGGGCCGGCATG
CACGAGGTCAAGCCGGGCACCATGGTCACCTTCGACCGCTCCGGGCTGCGCGAGCACGTC
TACTGGCGGCTGGAGGTCGCCGAGCACCGCGACGACACCGAGACCACCGTGCGGCGCGTC
CGCGAGATGCTGGAGGACAGCGTCGCCCGGCAGCTGGTCGCCGACGTGCCGCAGTGCGTC
CTGCTCTCCGGCGGCCTCGACTCCAGCGCCCTCACCGCCCTGGCCGGCCGCCGGCTGGCC
GCCGACGGCGAGCGCGCCCGCACGTTCACCGTCGACTTCGAGCAGTCGGACGCGTTCCGC
CCGGACGACCTGCGCGGCTCGCCGGACGCGCCGTTCGCCCGCGAGGTCGTTCAGCACGTC
GGCACGCTGCACCACGACATCAAGCTCGACTACCAGGAGCTGGCCAACCCCGAGGTGCGC
CGCGCCACGGTGACCGCCCGCGACCTGCCGTTCGGCTTCGGCGAGGCGGACAACTCGCTC
TACCTGCTCTTCAAGGCGATCCGCGAGCACTCGACGGTCGCGCTCTCCGGCGAGTCGTCG
GACGAGATCTTCGGCGGCTACCCCTGGTTCCACCTGCCGGCCGTCCAGCAGGTCCCGATG
TTCCCGTGGGTCACCGCCTCCGGCCTCGGCCCGCGCAACCACCCCACCAAGCTGATCGAC
CCCGACCTGCTGCTGCGCACCCTCGACGTCCCCGGCTACTGGGCCCAGCGCTGGAGCGAC
ACGGTCGCCGCCCTCCCGGTGGTGGCCGGCGAGGACGCGCACGAGCGGCGGATGCGCGAG
TTCTGCTACGTGCACCTGACCAGCCTGCTCGGCCTGCTGCTGGACCGGAAGGACCGGATG
AGCATGGCGGTCGGCCTGGAGGTGCGGGTGCCGTTCTGCGACCACCGGCTCGTCGAGTAC
GTGTTCAACACCCCCTGGGCGATGAAGACGTTCGACGGCCGCGAGAAGAGCCTGCTGCGG
GCCGCGGTCAAGGACGTGCTGCCCAGCTCGGTGGTGGAGCGCGTGAAGGCGCTCTACCCG
CACACCCAACAGCTCGCCTACGTCGGCCGGTTGCAGCAGCAGGTCGGCGAACTCCTGTCG
GCCGACCACGAGGCCGTGACGCTCTTCGACGGAGCCGCGCTCGCCAAGGCCGTCGCCGCG
CAGCCCGAGGCCGTCGACCGGGACGAGCGCGAGGCGTTCGAGCGCGTCCTCGACCTGGCC
GTCTGGCTCGACCTCTACCGCCCGACCATCAAGCTCTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000583 Class II glutamine amidotransferase domain (Domain)
 [48-169]  2.5e-43 PF13537
PF13537   GATase_7
IPR001962 Asparagine synthase (Domain)
 [240-536]  8.6e-65 PF00733
PF00733   Asn_synthase
IPR006426 Asparagine synthase, glutamine-hydrolyzing (Family)
 [2-537]  8.2e-149 TIGR01536
TIGR01536   asn_synth_AEB: asparagine synthase (glutamine-hydr
IPR014729 Rossmann-like alpha/beta/alpha sandwich fold (Domain)
 [454-603]  8.5e-73 G3DSA:3.40.50.620
G3DSA:3.40.50.620   no description
IPR017932 Glutamine amidotransferase type 2 domain (Domain)
 [2-214]  37.119 PS51278
PS51278   GATASE_TYPE_2
SignalP No significant hit
TMHMM No significant hit