close all open/close all

CDS information : Pier_00110


close this sectionLocation

Organism
Strain
Entry namePiericidin
Contig
Start / Stop / Direction46,881 / 47,654 / + [in whole cluster]
46,881 / 47,654 / + [in contig]
Location46881..47654 [in whole cluster]
46881..47654 [in contig]
TypeCDS
Length774 bp (257 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative O-methyltransferase
Product (GenBank)PieB2
GenepieB2
Gene (GenBank)
EC number2.1.1.-
Keyword
  • C-4'
Note
Note (GenBank)
  • methyltransferase
Reference
ACC
PmId
[22365607] Elucidation of Piericidin A1 biosynthetic locus revealed a thioesterase-dependent mechanism of alpha-pyridone ring formation. (Chem Biol. , 2012)
Related Reference
ACC
W0C915
PmId
[24409990] Elucidating hydroxylation and methylation steps tailoring piericidin A1 biosynthesis. (Org Lett. , 2014)

close this sectionSequence

selected fasta
>putative O-methyltransferase [PieB2]
MAVDNDVYNTHSWWHDDQPFATLEAFTPARFDYFHDVLTNRLRLDLAGLRVLDVGCGGGL
LAELYAKAGCKVTGMDPSGPSLEAARAHAAESGLEIEYQQGFAEKLPFPDGTFDVVYCCD
TLEHVTSVDQAVAEAVRVLKPGGYYLYDTINRTFRSKLAMIKMAQDWKSVSFAPKDLHDW
KSFIKPAELHEVFRRHGLANQDLIGFASKRPQLELLKAMRSRARGEITYGELGRQFQLGV
HKDTSVIYAGYARKAAN
selected fasta
>putative O-methyltransferase [PieB2]
ATGGCTGTCGACAACGACGTCTACAACACACACTCCTGGTGGCACGACGACCAGCCGTTC
GCCACCCTGGAGGCGTTCACCCCGGCCCGGTTCGACTACTTCCACGACGTGCTGACCAAC
CGGCTGCGGCTGGACCTCGCCGGCCTTCGCGTGCTCGACGTGGGCTGCGGCGGCGGCCTG
CTCGCCGAGCTCTACGCCAAGGCCGGCTGCAAGGTCACCGGCATGGACCCGTCCGGCCCC
TCGTTGGAGGCCGCCCGCGCCCACGCCGCCGAGTCCGGCCTGGAGATCGAGTACCAGCAG
GGCTTCGCCGAGAAGCTGCCCTTCCCGGACGGCACCTTCGACGTCGTCTACTGCTGCGAC
ACGCTGGAGCACGTCACCTCGGTGGACCAGGCGGTCGCCGAGGCGGTCCGGGTCCTCAAG
CCGGGCGGCTACTACCTGTACGACACGATCAACCGCACCTTCCGGTCCAAGCTCGCGATG
ATCAAGATGGCGCAGGACTGGAAGTCGGTCAGCTTCGCGCCCAAGGACCTCCACGACTGG
AAGAGCTTCATCAAGCCGGCCGAGCTGCACGAGGTCTTCCGCCGTCACGGCCTGGCCAAC
CAGGACCTGATCGGATTCGCCTCCAAGCGGCCGCAGTTGGAGCTGCTGAAGGCGATGCGG
AGCCGGGCCCGCGGCGAGATCACGTACGGCGAGCTGGGGCGGCAGTTCCAGCTCGGCGTT
CACAAGGACACGTCGGTGATCTACGCCGGCTATGCACGAAAGGCAGCAAACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010233 Ubiquinone biosynthesis O-methyltransferase (Family)
 [11-207]  1.2e-47 TIGR01983
TIGR01983   UbiG
IPR013216 Methyltransferase type 11 (Domain)
 [52-145]  2.2e-28 PF08241
PF08241   Methyltransf_11
SignalP No significant hit
TMHMM No significant hit