close all open/close all
Pier_00110 Pier_00110   last last

CDS information : Pier_00120


close this sectionLocation

Organism
Strain
Entry namePiericidin
Contig
Start / Stop / Direction47,657 / 49,420 / + [in whole cluster]
47,657 / 49,420 / + [in contig]
Location47657..49420 [in whole cluster]
47657..49420 [in contig]
TypeCDS
Length1,764 bp (587 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.1 modification hydroxylation
Productputative hydroxylase
Product (GenBank)PieE
GenepieE
Gene (GenBank)
EC number
Keyword
  • C-4'
Note
Note (GenBank)
  • monooxygenase, FAD-binding protein
Reference
ACC
PmId
[22365607] Elucidation of Piericidin A1 biosynthetic locus revealed a thioesterase-dependent mechanism of alpha-pyridone ring formation. (Chem Biol. , 2012)
Related Reference
ACC
W0C4C9
PmId
[24409990] Elucidating hydroxylation and methylation steps tailoring piericidin A1 biosynthesis. (Org Lett. , 2014)
ACC
Q3LG80
PmId
[16384790] Characterization of methylhydroquinone-metabolizing oxygenase genes encoded on plasmid in Burkholderia sp. NF100. (J Biosci Bioeng. , 2005)
ACC
P31020
PmId
[1650730] Sequence of the gene (pheA) encoding phenol monooxygenase from Pseudomonas sp. EST1001: expression in Escherichia coli and Pseudomonas putida. (Gene. , 1991)

close this sectionSequence

selected fasta
>putative hydroxylase [PieE]
MTTTTPDVRVPVLIVGAGPAGLTASLALSRYGVPHLVVGKYPGTAHTPRAHLLNQRTGEI
LRDLGVEPEVLAEATPSPLLANHIFMSTFAGPEVSRLDAYGNGPDRIGDYLAASPSKMCN
LPQHLMEPLLVEQVQQAGVGELRFGQEFLSLEQDEDGVTAVLADRQSGLQYTVRADYVIG
ADGANSRVMQQAGLTVEGATGLAKAATIWFEADLSRYCADRPAILFMGAVPGNPPEDGRV
FVSVRPWNEWVFLRFLDHDPDFDPEDHEEIRAHLQESIGDPSVEIRIKNVSPWEVNAVVA
PRYANGRVFCVGDAVHQMPPTNGLGLNSAVADSFNLCWKLKLVLDGTASPELLGTYEAER
VPVGAQIVDRAVRSMIDFLGIPAALGYAAGQSATEQWELLRGLADDTEEAAARRAALAAA
TDRINYQTNAHGVEIGYRYRAGARVDDGTPEPTQDRDPELYYQATTWPGARLPHAWLEDG
GRRRSTLDVVGQGRFVLLTGRGGERWHDAAREAARITGVPVAVRTIGAAEGLRDPYGAWE
RLREVEADGGVLVRPDGHVAWRARTADSAGELPKVLAAVLHTPAGPAV
selected fasta
>putative hydroxylase [PieE]
ATGACGACCACCACCCCCGACGTCCGCGTCCCGGTCCTGATCGTCGGCGCCGGACCGGCC
GGACTGACCGCCTCACTGGCGCTCTCCCGGTACGGCGTCCCGCACCTGGTCGTCGGCAAG
TACCCGGGCACCGCGCACACCCCGCGGGCCCACCTGCTGAACCAGCGCACCGGCGAGATC
CTGCGCGACCTCGGCGTCGAGCCCGAGGTCCTGGCCGAGGCGACGCCGAGCCCGCTGCTC
GCCAACCACATCTTCATGTCGACCTTCGCCGGCCCCGAGGTCAGCCGGCTGGACGCGTAC
GGCAACGGCCCGGACCGGATCGGCGACTACCTCGCCGCCAGCCCGAGCAAGATGTGCAAC
CTCCCGCAGCACCTGATGGAGCCGCTGCTGGTCGAGCAGGTCCAGCAGGCCGGGGTCGGC
GAACTCCGCTTCGGCCAGGAGTTCCTGAGCCTGGAGCAGGACGAGGACGGCGTCACCGCG
GTGCTCGCCGACCGCCAGTCCGGCCTGCAGTACACCGTGCGCGCCGACTACGTGATCGGC
GCCGACGGCGCCAACAGCCGGGTGATGCAGCAGGCGGGGCTCACCGTGGAGGGCGCCACC
GGCCTGGCCAAGGCGGCCACGATCTGGTTCGAGGCGGACCTCTCCCGCTACTGCGCCGAC
CGTCCCGCGATCCTCTTCATGGGCGCCGTGCCCGGCAACCCGCCGGAGGACGGCCGGGTG
TTCGTCAGCGTCCGCCCCTGGAACGAGTGGGTCTTCCTGCGCTTCCTCGACCACGACCCG
GACTTCGACCCCGAGGACCACGAGGAGATCCGCGCCCACCTGCAGGAGAGCATCGGCGAC
CCGTCCGTCGAGATCCGGATCAAGAACGTCTCGCCGTGGGAGGTCAACGCCGTCGTCGCC
CCCCGCTACGCGAACGGCCGGGTGTTTTGCGTCGGCGACGCCGTCCACCAGATGCCGCCC
ACCAACGGCCTCGGCCTCAACTCCGCGGTCGCGGACTCGTTCAACCTCTGTTGGAAGCTG
AAGCTGGTGCTGGACGGCACGGCCTCGCCCGAACTGCTCGGCACCTACGAGGCCGAGCGG
GTGCCGGTCGGCGCGCAGATCGTCGACCGCGCCGTCCGCAGCATGATCGACTTCCTCGGC
ATCCCGGCAGCGCTGGGCTACGCCGCCGGCCAGAGCGCGACCGAGCAGTGGGAGCTGCTG
CGCGGCCTCGCCGACGACACCGAGGAGGCCGCCGCCCGGCGGGCCGCCCTGGCCGCCGCG
ACCGACCGGATCAACTACCAGACGAACGCACACGGCGTCGAGATCGGCTACCGCTACCGC
GCCGGTGCCCGCGTCGACGACGGCACGCCGGAGCCGACCCAGGACCGCGACCCGGAGCTC
TACTACCAGGCCACCACCTGGCCGGGCGCCCGCCTGCCGCACGCCTGGCTGGAGGACGGC
GGGCGCCGCCGCTCCACCCTGGACGTGGTCGGCCAGGGCCGCTTCGTCCTGCTCACCGGC
CGCGGTGGCGAGCGCTGGCACGACGCGGCCCGCGAGGCCGCCCGGATCACCGGCGTGCCC
GTGGCCGTGCGCACGATCGGCGCCGCCGAGGGCCTGCGGGACCCGTACGGGGCGTGGGAG
CGGCTGCGCGAGGTCGAGGCCGACGGCGGTGTCCTGGTCCGCCCGGACGGGCACGTGGCC
TGGCGCGCCCGGACCGCCGACTCCGCCGGCGAGCTGCCCAAGGTGCTGGCCGCCGTCCTG
CACACGCCGGCCGGCCCGGCTGTC

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [10-371]  9.30000000000011e-100 PF01494
PF01494   FAD_binding_3
IPR003042 Aromatic-ring hydroxylase-like (Domain)
 [11-33]  6.29998179434732e-44 PR00420 [174-189]  6.29998179434732e-44 PR00420 [305-320]  6.29998179434732e-44 PR00420 [320-336]  6.29998179434732e-44 PR00420 [338-356]  6.29998179434732e-44 PR00420 [356-372]  6.29998179434732e-44 PR00420
PR00420   RNGMNOXGNASE
SignalP No significant hit
TMHMM No significant hit
Pier_00110 Pier_00110   last last