close all open/close all

CDS information : Pikro_00020


close this sectionLocation

Organism
StrainATCC 15439
Entry namePikromycin
Contig
Start / Stop / Direction2,293 / 1,283 / - [in whole cluster]
2,293 / 1,283 / - [in contig]
Locationcomplement(1283..2293) [in whole cluster]
complement(1283..2293) [in contig]
TypeCDS
Length1,011 bp (336 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
Product23S rRNA adenine N-6-methyltransferase
Product (GenBank)rRNA methyltransferase PikR1
Gene
Gene (GenBank)pikR1
EC number2.1.1.-
Keyword
Note
Note (GenBank)
  • mls type resistance protein
Reference
ACC
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[26438831] Resistance to ketolide antibiotics by coordinated expression of rRNA methyltransferases in a bacterial producer of natural ketolides. (Proc Natl Acad Sci U S A. , 2015)
Related Reference
ACC
Q6RX35
PmId
[15590712] Molecular basis of intrinsic macrolide resistance in clinical isolates of Mycobacterium fortuitum. (J Antimicrob Chemother. , 2005)
ACC
P07287
PmId
[7961464] Domain V of 23S rRNA contains all the structural elements necessary for recognition by the ErmE methyltransferase. (J Bacteriol. , 1994)
[7793855] Erythromycin resistance by ribosome modification. (Antimicrob Agents Chemother. , 1995)

close this sectionSequence

selected fasta
>23S rRNA adenine N-6-methyltransferase [rRNA methyltransferase PikR1]
MAMRDSIPRRADRDTLRRELGQNFLQDDRAVRNLVTHVEGDGRNVLEIGPGKGAITEELV
RSFDTVTVVEMDPHWAAHVRRKFEGERVTVFQGDFLDFRIPRDIDTVVGNVPFGITTQIL
RSLLESTNWQSAALIVQWEVARKRAGRSGGSLLTTSWAPWYEFAVHDRVRASSFRPMPRV
DGGVLTIRRRPQPLLPESASRAFQNFAEAVFTGPGRGLAEILRRHIPKRTYRSLADRHGI
PDGGLPKDLTLTQWIALFQASQPSYAPGAPGTRMPGQGGGAGGRDYDSETSRAAVPGSRR
YGPTRGGEPCAPRAQVRQTKGRQGARGSSYGRRTGR
selected fasta
>23S rRNA adenine N-6-methyltransferase [rRNA methyltransferase PikR1]
ATGGCAATGCGCGACTCCATACCGAGGCGAGCGGACCGCGACACCCTTCGCCGCGAATTA
GGCCAGAACTTCCTTCAGGACGACAGAGCCGTGCGCAATCTCGTCACGCATGTCGAGGGG
GACGGTAGGAACGTTCTCGAAATCGGCCCCGGAAAGGGCGCGATAACCGAGGAGTTGGTG
CGCTCCTTCGACACCGTGACGGTCGTGGAGATGGACCCGCACTGGGCCGCGCATGTGCGG
CGGAAATTCGAAGGGGAGAGGGTCACCGTATTCCAGGGTGATTTCCTCGACTTCCGCATT
CCGCGCGATATCGACACCGTCGTCGGAAACGTTCCCTTCGGCATCACGACCCAGATTCTC
CGGAGTCTCCTGGAATCGACGAACTGGCAGTCGGCGGCCCTGATAGTGCAGTGGGAGGTC
GCCCGCAAACGCGCCGGTCGCAGCGGCGGATCGCTCCTCACGACCTCCTGGGCCCCCTGG
TACGAGTTCGCGGTCCACGACCGCGTCCGCGCCTCGTCGTTCCGTCCGATGCCCCGCGTC
GACGGCGGCGTCCTGACGATCAGGCGACGCCCCCAGCCCCTGCTGCCCGAGAGCGCGAGC
CGCGCCTTCCAGAACTTCGCCGAAGCCGTCTTCACCGGCCCCGGACGGGGCCTCGCGGAG
ATCCTCCGGCGCCACATCCCCAAGCGGACCTACCGTTCCCTCGCCGACCGCCACGGAATT
CCGGACGGCGGACTGCCGAAGGACCTCACGCTCACCCAATGGATCGCCCTTTTCCAGGCC
TCCCAGCCGAGTTACGCGCCGGGGGCGCCCGGCACGCGCATGCCGGGCCAGGGCGGTGGC
GCCGGCGGCAGGGACTATGACTCGGAGACGAGCAGGGCCGCCGTGCCCGGGAGCCGCAGA
TACGGCCCCACGCGCGGCGGCGAACCCTGCGCACCCCGCGCACAGGTCCGGCAGACCAAG
GGCCGCCAGGGCGCGCGAGGCTCGTCGTACGGACGCCGCACGGGCCGTTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001737 Ribosomal RNA adenine methylase transferase (Family)
 [14-260]  9.29999999999998e-58 PF00398
PF00398   RrnaAD
IPR020596 Ribosomal RNA adenine methylase transferase, conserved site (Conserved_site)
 [45-72]  PS01131
PS01131   RRNA_A_DIMETH
IPR020598 Ribosomal RNA adenine methylase transferase, N-terminal (Domain)
 [30-191]  4.69998262513189e-70 SM00650
SM00650   rADc
SignalP No significant hit
TMHMM No significant hit