close all open/close all

CDS information : Pikro_00030


close this sectionLocation

Organism
StrainATCC 15439
Entry namePikromycin
Contig
Start / Stop / Direction2,912 / 16,753 / + [in whole cluster]
2,912 / 16,753 / + [in contig]
Location2912..16753 [in whole cluster]
2912..16753 [in contig]
TypeCDS
Length13,842 bp (4,613 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I polyketide synthase PikAI
Gene
Gene (GenBank)pikAI
EC number
Keyword
Note
Note (GenBank)
  • multifunctional polyketide synthase; contains a loading module, Pik module 1 and module 2
Reference
ACC
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[10421766] Elucidating the mechanism of chain termination switching in the picromycin/methymycin polyketide synthase. (Chem Biol. , 1999)
[10662693] Formation of functional heterologous complexes using subunits from the picromycin, erythromycin and oleandomycin polyketide synthases. (Chem Biol. , 2000)
[10713461] Genetic architecture of the polyketide synthases for methymycin and pikromycin series macrolides. (Gene. , 2000)
[25299319] Polyketide intermediate mimics as probes for revealing cryptic stereochemistry of ketoreductase domains. (ACS Chem Biol. , 2014)
[26027428] Functional Characterization of a Dehydratase Domain from the Pikromycin Polyketide Synthase. (J Am Chem Soc. , 2015)

close this sectionPKS/NRPS Module

0 methylmalonyl-CoA
1 methylmalonyl-CoA
2 malonyl-CoA
KSQ89..464
AT634..943
ACP1012..1082
KS1108..1485
AT1650..1960
KR2208..2387
ACP2497..2567
KS2604..2979
AT3180..3527
DH3579..3753
KR4100..4282
ACP4409..4479

close this sectionSequence

selected fasta
>polyketide synthase [type I polyketide synthase PikAI]
MSSAGITRTGARTPVTGRGAAAWDTGEVRVRRGLPPAGPDHAEHSFSRAPTGDVRAELIR
GEMSTVSKSESEEFVSVSNDAGSAHGTAEPVAVVGISCRVPGARDPREFWELLAAGGQAV
TDVPADRWNAGDFYDPDRSAPGRSNSRWGGFIEDVDRFDAAFFGISPREAAEMDPQQRLA
LELGWEALERAGIDPSSLTGTRTGVFAGAIWDDYATLKHRQGGAAITPHTVTGLHRGIIA
NRLSYTLGLRGPSMVVDSGQSSSLVAVHLACESLRRGESELALAGGVSLNLVPDSIIGAS
KFGGLSPDGRAYTFDARANGYVRGEGGGFVVLKRLSRAVADGDPVLAVIRGSAVNNGGAA
QGMTTPDAQAQEAVLREAHERAGTAPADVRYVELHGTGTPVGDPIEAAALGAALGTGRPA
GQPLLVGSVKTNIGHLEGAAGIAGLIKAVLAVRGRALPASLNYETPNPAIPFEELNLRVN
TEYLPWEPEHDGQRMVVGVSSFGMGGTNAHVVLEEAPGGCRGASVVESTVGGSAVGGGVV
PWVVSAKSAAALDAQIERLAAFASRDRTDGVDAGAVDAGAVDAGAVARVLAGGRAQFEHR
AVVVGSGPDDLAAALAAPEGLVRGVASGVGRVAFVFPGQGTQWAGMGAELLDSSAVFAAA
MAECEAALSPYVDWSLEAVVRQAPGAPTLERVDVVQPVTFAVMVSLARVWQHHGVTPQAV
VGHSQGEIAAAYVAGALSLDDAARVVTLRSKSIAAHLAGKGGMLSLALSEDAVLERLAGF
DGLSVAAVNGPTATVVSGDPVQIEELARACEADGVRARVIPVDYASHSRQVEIIESELAE
VLAGLSPQAPRVPFFSTLEGAWITEPVLDGGYWYRNLRHRVGFAPAVETLATDEGFTHFV
EVSAHPVLTMALPGTVTGLATLRRDNGGQDRLVASLAEAWANGLAVDWSPLLPSATGHHS
DLPTYAFQTERHWLGEIEALAPAGEPAVQPAVLRTEAAEPAELDRDEQLRVILDKVRAQT
AQVLGYATGGQIEVDRTFREAGCTSLTGVDLRNRINAAFGVRMAPSMIFDFPTPEALAEQ
LLLVVHGEAAANPAGAEPAPVAAAGAVDEPVAIVGMACRLPGGVASPEDLWRLVAGGGDA
ISEFPQDRGWDVEGLYHPDPEHPGTSYVRQGGFIENVAGFDAAFFGISPREALAMDPQQR
LLLETSWEAVEDAGIDPTSLRGRQVGVFTGAMTHEYGPSLRDGGEGLDGYLLTGNTASVM
SGRVSYTLGLEGPALTVDTACSSSLVALHLAVQALRKGEVDMALAGGVAVMPTPGMFVEF
SRQRGLAGDGRSKAFAASADGTSWSEGVGVLLVERLSDARRNGHQVLAVVRGSALNQDGA
SNGLTAPNGPSQQRVIRRALADARLTTSDVDVVEAHGTGTRLGDPIEAQALIATYGQGRD
DEQPLRLGSLKSNIGHTQAAAGVSGVIKMVQAMRHGLLPKTLHVDEPSDQIDWSAGAVEL
LTEAVDWPEKQDGGLRRAAVSSFGISGTNAHVVLEEAPVVVEGASVVEPSVGGSAVGGGV
TPWVVSAKSAAALDAQIERLAAFASRDRTDDADAGAVDAGAVAHVLADGRAQFEHRAVAL
GAGADDLVQALADPDGLIRGTASGVGRVAFVFPGQGTQWAGMGAELLDSSAVFAAAMAEC
EAALSPYVDWSLEAVVRQAPGAPTLERVDVVQPVTFAVMVSLARVWQHHGVTPQAVVGHS
QGEIAAAYVAGALPLDDAARVVTLRSKSIAAHLAGKGGMLSLALNEDAVLERLSDFDGLS
VAAVNGPTATVVSGDPVQIEELAQACKADGFRARIIPVDYASHSRQVEIIESELAQVLAG
LSPQAPRVPFFSTLEGTWITEPVLDGTYWYRNLRHRVGFAPAIETLAVDEGFTHFVEVSA
HPVLTMTLPETVTGLGTLRREQGGQERLVTSLAEAWVNGLPVAWTSLLPATASRPGLPTY
AFQAERYWLENTPAALATGDDWRYRIDWKRLPAAEGSERTGLSGRWLAVTPEDHSAQAAA
VLTALVDAGAKVEVLTAGADDDREALAARLTALTTGDGFTGVVSLLDGLVPQVAWVQALG
DAGIKAPLWSVTQGAVSVGRLDTPADPDRAMLWGLGRVVALEHPERWAGLVDLPAQPDAA
ALAHLVTALSGATGEDQIAIRTTGLHARRLARAPLHGRRPTRDWQPHGTVLITGGTGALG
SHAARWMAHHGAEHLLLVSRSGEQAPGATQLTAELTASGARVTIAACDVADPHAMRTLLD
AIPAETPLTAVVHTAGALDDGIVDTLTAEQVRRAHRAKAVGASVLDELTRDLDLDAFVLF
SSVSSTLGIPGQGNYAPHNAYLDALAARRRATGRSAVSVAWGPWDGGGMAAGDGVAERLR
NHGVPGMDPELALAALESALGRDETAITVADIDWDRFYLAYSSGRPQPLVEELPEVRRII
DARDSATSGQGGSSAQGANPLAERLAAAAPGERTEILLGLVRAQAAAVLRMRSPEDVAAD
RAFKDIGFDSLAGVELRNRLTRATGLQLPATLVFDHPTPLALVSLLRSEFLGDEETADAR
RSAALPATVGAGAGAGAGTDADDDPIAIVAMSCRYPGDIRSPEDLWRMLSEGGEGITPFP
TDRGWDLDGLYDADPDALGRAYVREGGFLHDAAEFDAEFFGVSPREALAMDPQQRMLLTT
SWEAFERAGIEPASLRGSSTGVFIGLSYQDYAARVPNAPRGVEGYLLTGSTPSVASGRIA
YTFGLEGPATTVDTACSSSLTALHLAVRALRSGECTMALAGGVAMMATPHMFVEFSRQRA
LAPDGRSKAFSADADGFGAAEGVGLLLVERLSDARRNGHPVLAVVRGTAVNQDGASNGLT
APNGPSQQRVIRQALADARLAPGDIDAVETHGTGTSLGDPIEAQGLQATYGKERPAERPL
AIGSVKSNIGHTQAAAGAAGIIKMVLAMRHGTLPKTLHADEPSPHVDWANSGLALVTEPI
DWPAGTGPRRAAVSSFGISGTNAHVVLEQAPDAAGEVLGADEVPEVSETVAMAGTAGTSE
VAEGSEASEAPAAPGSREASLPGHLPWVLSAKDEQSLRGQAAALHAWLSEPAADLSDADG
PARLRDVGYTLATSRTAFAHRAAVTAADRDGFLDGLATLAQGGTSAHVHLDTARDGTTAF
LFTGQGSQRPGAGRELYDRHPVFARALDEICAHLDGHLELPLLDVMFAAEGSAEAALLDE
TRYTQCALFALEVALFRLVESWGMRPAALLGHSVGEIAAAHVAGVFSLADAARLVAARGR
LMQELPAGGAMLAVQAAEDEIRVWLETEERYAGRLDVAAVNGPEAAVLSGDADAAREAEA
YWSGLGRRTRALRVSHAFHSAHMDGMLDGFRAVLETVEFRRPSLTVVSNVTGLAAGPDDL
CDPEYWVRHVRGTVRFLDGVRVLRDLGVRTCLELGPDGVLTAMAADGLADTPADSAAGSP
VGSPAGSPADSAAGALRPRPLLVALLRRKRSETETVADALGRAHAHGTGPDWHAWFAGSG
AHRVDLPTYSFRRDRYWLDAPAADTAVDTAGLGLGTADHPLLGAVVSLPDRDGLLLTGRL
SLRTHPWLADHAVLGSVLLPGAAMVELAAHAAESAGLRDVRELTLLEPLVLPEHGGVELR
VTVGAPAGEPGGESAGDGARPVSLHSRLADAPAGTAWSCHATGLLATDRPELPVAPDRAA
MWPPQGAEEVPLDGLYERLDGNGLAFGPLFQGLNAVWRYEGEVFADIALPATTNATAPAT
ANGGGSAAAAPYGIHPALLDASLHAIAVGGLVDEPELVRVPFHWSGVTVHAAGAAAARVR
LASAGTDAVSLSLTDGEGRPLVSVERLTLRPVTADQAAASRVGGLMHRVAWRPYALASSG
EQDPHATSYGPTAVLGKDELKVAAALESAGVEVGLYPDLAALSQDVAAGAPAPRTVLAPL
PAGPADGGAEGVRGTVARTLELLQAWLADEHLAGTRLLLVTRGAVRDPEGSGADDGGEDL
SHAAAWGLVRTAQTENPGRFGLLDLADDASSYRTLPSVLSDAGLRDEPQLALHDGTIRLA
RLASVRPETGTAAPALAPEGTVLLTGGTGGLGGLVARHVVGEWGVRRLLLVSRRGTDAPG
ADELVHELEALGADVSVAACDVADREALTAVLDAIPAEHPLTAVVHTAGVLSDGTLPSMT
TEDVEHVLRPKVDAAFLLDELTSTPAYDLAAFVMFSSAAAVFGGAGQGAYAAANATLDAL
AWRRRAAGLPALSLGWGLWAETSGMTGELGQADLRRMSRAGIGGISDAEGIALLDAALRD
DRHPVLLPLRLDAAGLRDAAGNDPAGIPALFRDVVGARTVRARPSAASASTTAGTAGTPG
TADGAAETAAVTLADRAATVDGPARQRLLLEFVVGEVAEVLGHARGHRIDAERGFLDLGF
DSLTAVELRNRLNSAGGLALPATLVFDHPSPAALASHLDAELPRGASDQDGAGNRNGNEN
GTTASRSTAETDALLAQLTRLEGALVLTGLSDAPGSEEVLEHLRSLRSMVTGETGTGTAS
GAPDGAGSGAEDRPWAAGDGAGGGSEDGAGVPDFMNASAEELFGLLDQDPSTD
selected fasta
>polyketide synthase [type I polyketide synthase PikAI]
ATGTCTTCAGCCGGAATTACCAGGACCGGTGCGAGAACACCGGTGACAGGGCGTGGGGCG
GCAGCGTGGGACACGGGGGAAGTGCGGGTCCGACGGGGGTTGCCCCCTGCCGGCCCCGAT
CATGCGGAGCACTCCTTCTCTCGTGCTCCTACCGGTGATGTGCGCGCCGAATTGATTCGT
GGAGAGATGTCGACAGTGTCCAAGAGTGAGTCCGAGGAATTCGTGTCCGTGTCGAACGAC
GCCGGTTCCGCGCACGGCACAGCGGAACCCGTCGCCGTCGTCGGCATCTCCTGCCGGGTG
CCCGGCGCCCGGGACCCGAGAGAGTTCTGGGAACTCCTGGCGGCAGGCGGCCAGGCCGTC
ACCGACGTCCCCGCGGACCGCTGGAACGCCGGCGACTTCTACGACCCGGACCGCTCCGCC
CCCGGCCGCTCGAACAGCCGGTGGGGCGGGTTCATCGAGGACGTCGACCGGTTCGACGCC
GCCTTCTTCGGCATCTCGCCCCGCGAGGCCGCGGAGATGGACCCGCAGCAGCGGCTCGCC
CTGGAGCTGGGCTGGGAGGCCCTGGAGCGCGCCGGGATCGACCCGTCCTCGCTCACCGGC
ACCCGCACCGGCGTCTTCGCCGGCGCCATCTGGGACGACTACGCCACCCTGAAGCACCGC
CAGGGCGGCGCCGCGATCACCCCGCACACCGTCACCGGCCTCCACCGCGGCATCATCGCG
AACCGACTCTCGTACACGCTCGGGCTCCGCGGCCCCAGCATGGTCGTCGACTCCGGCCAG
TCCTCGTCGCTCGTCGCCGTCCACCTCGCGTGCGAGAGCCTGCGGCGCGGCGAGTCCGAG
CTCGCCCTCGCCGGCGGCGTCTCGCTCAACCTGGTGCCGGACAGCATCATCGGGGCGAGC
AAGTTCGGCGGCCTCTCCCCCGACGGCCGCGCCTACACCTTCGACGCGCGCGCCAACGGC
TACGTACGCGGCGAGGGCGGCGGTTTCGTCGTCCTGAAGCGCCTCTCCCGGGCCGTCGCC
GACGGCGACCCGGTGCTCGCCGTGATCCGGGGCAGCGCCGTCAACAACGGCGGCGCCGCC
CAGGGCATGACGACCCCCGACGCGCAGGCGCAGGAGGCCGTGCTCCGCGAGGCCCACGAG
CGGGCCGGGACCGCGCCGGCCGACGTGCGGTACGTCGAGCTGCACGGCACCGGCACCCCC
GTGGGCGACCCGATCGAGGCCGCTGCGCTCGGCGCCGCCCTCGGCACCGGCCGCCCGGCC
GGACAGCCGCTCCTGGTCGGCTCGGTCAAGACGAACATCGGCCACCTGGAGGGCGCGGCC
GGCATCGCCGGCCTCATCAAGGCCGTCCTGGCGGTCCGCGGTCGCGCGCTGCCCGCCAGC
CTGAACTACGAGACCCCGAACCCGGCGATCCCGTTCGAGGAACTGAACCTCCGGGTGAAC
ACGGAGTACCTGCCGTGGGAGCCGGAGCACGACGGGCAGCGGATGGTCGTCGGCGTGTCC
TCGTTCGGCATGGGCGGCACGAACGCGCATGTCGTGCTCGAAGAGGCCCCCGGGGGTTGT
CGAGGTGCTTCGGTCGTGGAGTCGACGGTCGGCGGGTCGGCGGTCGGCGGCGGTGTGGTG
CCGTGGGTGGTGTCGGCGAAGTCCGCTGCCGCGCTGGACGCGCAGATCGAGCGGCTTGCC
GCGTTCGCCTCGCGGGATCGTACGGATGGTGTCGACGCGGGCGCTGTCGATGCGGGTGCT
GTCGATGCGGGTGCTGTCGCTCGCGTACTGGCCGGCGGGCGTGCTCAGTTCGAGCACCGG
GCCGTCGTCGTCGGCAGCGGGCCGGACGATCTGGCGGCAGCGCTGGCCGCGCCTGAGGGT
CTGGTCCGGGGCGTGGCTTCCGGTGTCGGGCGAGTGGCGTTCGTGTTCCCCGGGCAGGGC
ACGCAGTGGGCCGGCATGGGTGCCGAACTGCTGGACTCTTCCGCGGTGTTCGCGGCGGCC
ATGGCCGAATGCGAGGCCGCACTCTCCCCGTACGTCGACTGGTCGCTGGAGGCCGTCGTA
CGGCAGGCCCCCGGTGCGCCCACGCTGGAGCGGGTCGATGTCGTGCAGCCTGTGACGTTC
GCCGTCATGGTCTCGCTGGCTCGCGTGTGGCAGCACCACGGGGTGACGCCCCAGGCGGTC
GTCGGCCACTCGCAGGGCGAGATCGCCGCCGCGTACGTCGCCGGTGCCCTGAGCCTGGAC
GACGCCGCTCGTGTCGTGACCCTGCGCAGCAAGTCCATCGCCGCCCACCTCGCCGGCAAG
GGCGGCATGCTGTCCCTCGCGCTGAGCGAGGACGCCGTCCTGGAGCGACTGGCCGGGTTC
GACGGGCTGTCCGTCGCCGCTGTGAACGGGCCCACCGCCACCGTGGTCTCCGGTGACCCC
GTACAGATCGAAGAGCTTGCTCGGGCGTGTGAGGCCGATGGGGTCCGTGCGCGGGTCATT
CCCGTCGACTACGCGTCCCACAGCCGGCAGGTCGAGATCATCGAGAGCGAGCTCGCCGAG
GTCCTCGCCGGGCTCAGCCCGCAGGCTCCGCGCGTGCCGTTCTTCTCGACACTCGAAGGC
GCCTGGATCACCGAGCCCGTGCTCGACGGCGGCTACTGGTACCGCAACCTGCGCCATCGT
GTGGGCTTCGCCCCGGCCGTCGAGACCCTGGCCACCGACGAGGGCTTCACCCACTTCGTC
GAGGTCAGCGCCCACCCCGTCCTCACCATGGCCCTCCCCGGGACCGTCACCGGTCTGGCG
ACCCTGCGTCGCGACAACGGCGGTCAGGACCGCCTAGTCGCCTCCCTCGCCGAAGCATGG
GCCAACGGACTCGCGGTCGACTGGAGCCCGCTCCTCCCCTCCGCGACCGGCCACCACTCC
GACCTCCCCACCTACGCGTTCCAGACCGAGCGCCACTGGCTGGGCGAGATCGAGGCGCTC
GCCCCGGCGGGCGAGCCGGCGGTGCAGCCCGCCGTCCTCCGCACGGAGGCGGCCGAGCCG
GCGGAGCTCGACCGGGACGAGCAGCTGCGCGTGATCCTGGACAAGGTCCGGGCGCAGACG
GCCCAGGTGCTGGGGTACGCGACAGGCGGGCAGATCGAGGTCGACCGGACCTTCCGTGAG
GCCGGTTGCACCTCCCTGACCGGCGTGGACCTGCGCAACCGGATCAACGCCGCCTTCGGC
GTACGGATGGCGCCGTCCATGATCTTCGACTTCCCCACCCCCGAGGCTCTCGCGGAGCAG
CTGCTCCTCGTCGTGCACGGGGAGGCGGCGGCGAACCCGGCCGGTGCGGAGCCGGCTCCG
GTGGCGGCGGCCGGTGCCGTCGACGAGCCGGTGGCGATCGTCGGCATGGCCTGCCGCCTG
CCCGGTGGGGTCGCCTCGCCGGAGGACCTGTGGCGGCTGGTGGCCGGCGGCGGGGACGCG
ATCTCGGAGTTCCCGCAGGACCGCGGCTGGGACGTGGAGGGGCTGTACCACCCGGATCCG
GAGCACCCCGGCACGTCGTACGTCCGCCAGGGCGGTTTCATCGAGAACGTCGCCGGCTTC
GACGCGGCCTTCTTCGGGATCTCGCCGCGCGAGGCCCTCGCCATGGACCCGCAGCAGCGG
CTCCTCCTCGAAACCTCCTGGGAGGCCGTCGAGGACGCCGGGATCGACCCGACCTCCCTG
CGGGGACGGCAGGTCGGCGTCTTCACTGGGGCGATGACCCACGAGTACGGGCCGAGCCTG
CGGGACGGCGGGGAAGGCCTCGACGGCTACCTGCTGACCGGCAACACGGCCAGCGTGATG
TCGGGCCGCGTCTCGTACACACTCGGCCTTGAGGGCCCCGCCCTGACGGTGGACACGGCC
TGCTCGTCGTCGCTGGTCGCCCTGCACCTCGCCGTGCAGGCCCTGCGCAAGGGCGAGGTC
GACATGGCGCTCGCCGGCGGCGTGGCCGTGATGCCCACGCCCGGGATGTTCGTCGAGTTC
AGCCGGCAGCGCGGGCTGGCCGGGGACGGCCGGTCGAAGGCGTTCGCCGCGTCGGCGGAC
GGCACCAGCTGGTCCGAGGGCGTCGGCGTCCTCCTCGTCGAGCGCCTGTCGGACGCCCGC
CGCAACGGACACCAGGTCCTCGCGGTCGTCCGCGGCAGCGCCTTGAACCAGGACGGCGCG
AGCAACGGCCTCACGGCTCCGAACGGGCCCTCGCAGCAGCGCGTCATCCGGCGCGCGCTG
GCGGACGCCCGGCTGACGACCTCCGACGTGGACGTCGTCGAGGCACACGGCACGGGCACG
CGACTCGGCGACCCGATCGAGGCGCAGGCCCTGATCGCCACCTACGGCCAGGGCCGTGAC
GACGAACAGCCGCTGCGCCTCGGGTCGTTGAAGTCCAACATCGGGCACACCCAGGCCGCG
GCCGGCGTCTCCGGTGTCATCAAGATGGTCCAGGCGATGCGCCACGGACTGCTGCCGAAG
ACGCTGCACGTCGACGAGCCCTCGGACCAGATCGACTGGTCGGCTGGCGCCGTGGAACTC
CTCACCGAGGCCGTCGACTGGCCGGAGAAGCAGGACGGCGGGCTGCGCCGGGCCGCCGTC
TCCTCCTTCGGGATCAGCGGCACCAATGCGCATGTGGTGCTCGAAGAGGCCCCGGTGGTT
GTCGAGGGTGCTTCGGTCGTCGAGCCGTCGGTTGGCGGGTCGGCGGTCGGCGGCGGTGTG
ACGCCTTGGGTGGTGTCGGCGAAGTCCGCTGCCGCGCTCGACGCGCAGATCGAGCGGCTT
GCCGCATTCGCCTCGCGGGATCGTACGGATGACGCCGACGCCGGTGCTGTCGACGCGGGC
GCTGTCGCTCACGTACTGGCTGACGGGCGTGCTCAGTTCGAGCACCGGGCCGTCGCGCTC
GGCGCCGGGGCGGACGACCTCGTACAGGCGCTGGCCGATCCGGACGGGCTGATACGCGGA
ACGGCTTCCGGTGTCGGGCGAGTGGCGTTCGTGTTCCCCGGTCAGGGCACGCAGTGGGCT
GGCATGGGTGCCGAACTGCTGGACTCTTCCGCGGTGTTCGCGGCGGCCATGGCCGAGTGT
GAGGCCGCGCTGTCCCCGTACGTCGACTGGTCGCTGGAGGCCGTCGTACGGCAGGCCCCC
GGTGCGCCCACGCTGGAGCGGGTCGATGTCGTGCAGCCTGTGACGTTCGCCGTCATGGTC
TCGCTGGCTCGCGTGTGGCAGCACCACGGTGTGACGCCCCAGGCGGTCGTCGGCCACTCG
CAGGGCGAGATCGCCGCCGCGTACGTCGCCGGAGCCCTGCCCCTGGACGACGCCGCCCGC
GTCGTCACCCTGCGCAGCAAGTCCATCGCCGCCCACCTCGCCGGCAAGGGCGGCATGCTG
TCCCTCGCGCTGAACGAGGACGCCGTCCTGGAGCGACTGAGTGACTTCGACGGGCTGTCC
GTCGCCGCCGTCAACGGGCCCACCGCCACTGTCGTGTCGGGTGACCCCGTACAGATCGAA
GAGCTTGCTCAGGCGTGCAAGGCGGACGGATTCCGCGCGCGGATCATTCCCGTCGACTAC
GCGTCCCACAGCCGGCAGGTCGAGATCATCGAGAGCGAGCTCGCCCAGGTCCTCGCCGGT
CTCAGCCCGCAGGCCCCGCGCGTGCCGTTCTTCTCGACGCTCGAAGGCACCTGGATCACC
GAGCCCGTCCTCGACGGCACCTACTGGTACCGCAACCTCCGTCACCGCGTCGGCTTCGCC
CCCGCCATCGAGACCCTGGCCGTCGACGAGGGCTTCACGCACTTCGTCGAGGTCAGCGCC
CACCCCGTCCTCACCATGACCCTCCCCGAGACCGTCACCGGCCTCGGCACCCTCCGTCGC
GAACAGGGAGGCCAAGAGCGTCTGGTCACCTCGCTCGCCGAGGCGTGGGTCAACGGGCTT
CCCGTGGCATGGACTTCGCTCCTGCCCGCCACGGCCTCCCGCCCCGGTCTGCCCACCTAC
GCCTTCCAGGCCGAGCGCTACTGGCTCGAGAACACTCCCGCCGCCCTGGCCACCGGCGAC
GACTGGCGCTACCGCATCGACTGGAAGCGCCTCCCGGCCGCCGAGGGGTCCGAGCGCACC
GGCCTGTCCGGCCGCTGGCTCGCCGTCACGCCGGAGGACCACTCCGCGCAGGCCGCCGCC
GTGCTCACCGCGCTGGTCGACGCCGGGGCGAAGGTCGAGGTGCTGACGGCCGGGGCGGAC
GACGACCGTGAGGCCCTCGCCGCCCGGCTCACCGCACTGACGACCGGTGACGGCTTCACC
GGCGTGGTCTCGCTCCTCGACGGACTCGTACCGCAGGTCGCCTGGGTCCAGGCGCTCGGC
GACGCCGGAATCAAGGCGCCCCTGTGGTCCGTCACCCAGGGCGCGGTCTCCGTCGGACGT
CTCGACACCCCCGCCGACCCCGACCGGGCCATGCTCTGGGGCCTCGGCCGCGTCGTCGCC
CTTGAGCACCCCGAACGCTGGGCCGGCCTCGTCGACCTCCCCGCCCAGCCCGATGCCGCC
GCCCTCGCCCACCTCGTCACCGCACTCTCCGGCGCCACCGGCGAGGACCAGATCGCCATC
CGCACCACCGGACTCCACGCCCGCCGCCTCGCCCGCGCACCCCTCCACGGACGTCGGCCC
ACCCGCGACTGGCAGCCCCACGGCACCGTCCTCATCACCGGCGGCACCGGAGCCCTCGGC
AGCCACGCCGCACGCTGGATGGCCCACCACGGAGCCGAACACCTCCTCCTCGTCAGCCGC
AGCGGCGAACAAGCCCCCGGAGCCACCCAACTCACCGCCGAACTCACCGCATCGGGCGCC
CGCGTCACCATCGCCGCCTGCGACGTCGCCGACCCCCACGCCATGCGCACCCTCCTCGAC
GCCATCCCCGCCGAGACGCCCCTCACCGCCGTCGTCCACACCGCCGGCGCGCTCGACGAC
GGCATCGTGGACACGCTGACCGCCGAGCAGGTCCGGCGGGCCCACCGTGCGAAGGCCGTC
GGCGCCTCGGTGCTCGACGAGCTGACCCGGGACCTCGACCTCGACGCGTTCGTGCTCTTC
TCGTCCGTGTCGAGCACTCTGGGCATCCCCGGTCAGGGCAACTACGCCCCGCACAACGCC
TACCTCGACGCCCTCGCGGCTCGCCGCCGGGCCACCGGCCGGTCCGCCGTCTCGGTGGCC
TGGGGACCGTGGGACGGTGGCGGCATGGCCGCCGGTGACGGCGTGGCCGAGCGGCTGCGC
AACCACGGCGTGCCCGGCATGGACCCGGAACTCGCCCTGGCCGCACTGGAGTCCGCGCTC
GGCCGGGACGAGACCGCGATCACCGTCGCGGACATCGACTGGGACCGCTTCTACCTCGCG
TACTCCTCCGGTCGCCCGCAGCCCCTCGTCGAGGAGCTGCCCGAGGTGCGGCGCATCATC
GACGCACGGGACAGCGCCACGTCCGGACAGGGCGGGAGCTCCGCCCAGGGCGCCAACCCC
CTGGCCGAGCGGCTGGCCGCCGCGGCTCCCGGCGAGCGTACGGAGATCCTCCTCGGTCTC
GTACGGGCGCAGGCCGCCGCCGTGCTCCGGATGCGTTCGCCGGAGGACGTCGCCGCCGAC
CGCGCCTTCAAGGACATCGGCTTCGACTCGCTCGCCGGTGTCGAGCTGCGCAACAGGCTG
ACCCGGGCGACCGGGCTCCAGCTGCCCGCGACGCTCGTCTTCGACCACCCGACGCCGCTG
GCCCTCGTGTCGCTGCTCCGCAGCGAGTTCCTCGGTGACGAGGAGACGGCGGACGCCCGG
CGGTCCGCGGCGCTGCCCGCGACTGTCGGTGCCGGTGCCGGCGCCGGCGCCGGCACCGAT
GCCGACGACGATCCGATCGCGATCGTCGCGATGAGCTGCCGCTACCCCGGTGACATCCGC
AGCCCGGAGGACCTGTGGCGGATGCTGTCCGAGGGCGGCGAGGGCATCACGCCGTTCCCC
ACCGACCGCGGCTGGGACCTCGACGGCCTGTACGACGCCGACCCGGACGCGCTCGGCAGG
GCGTACGTCCGCGAGGGCGGGTTCCTGCACGACGCGGCCGAGTTCGACGCGGAGTTCTTC
GGCGTCTCGCCGCGCGAGGCGCTGGCCATGGACCCGCAGCAGCGGATGCTCCTGACGACG
TCCTGGGAGGCCTTCGAGCGGGCCGGCATCGAGCCGGCATCGCTGCGCGGCAGCAGCACC
GGTGTCTTCATCGGCCTCTCCTACCAGGACTACGCGGCCCGCGTCCCGAACGCCCCGCGT
GGCGTGGAGGGTTACCTGCTGACCGGCAGCACGCCGAGCGTCGCGTCGGGCCGTATCGCG
TACACCTTCGGTCTCGAAGGGCCCGCGACGACCGTCGACACCGCCTGCTCGTCGTCGCTG
ACCGCCCTGCACCTGGCGGTGCGGGCGCTGCGCAGCGGCGAGTGCACGATGGCGCTCGCC
GGTGGCGTGGCGATGATGGCGACCCCGCACATGTTCGTGGAGTTCAGCCGTCAGCGGGCG
CTCGCCCCGGACGGCCGCAGCAAGGCCTTCTCGGCGGACGCCGACGGGTTCGGCGCCGCG
GAGGGCGTCGGCCTGCTGCTCGTGGAGCGGCTCTCGGACGCGCGGCGCAACGGTCACCCG
GTGCTCGCCGTGGTCCGCGGTACCGCCGTCAACCAGGACGGCGCCAGCAACGGGCTGACC
GCGCCCAACGGACCCTCGCAGCAGCGGGTGATCCGGCAGGCGCTCGCCGACGCCCGGCTG
GCACCCGGCGACATCGACGCCGTCGAGACGCACGGCACGGGAACCTCGCTGGGCGACCCC
ATCGAGGCCCAGGGCCTCCAGGCCACGTACGGCAAGGAGCGGCCCGCGGAACGGCCGCTC
GCCATCGGCTCCGTGAAGTCCAACATCGGACACACCCAGGCCGCGGCCGGTGCGGCGGGC
ATCATCAAGATGGTCCTCGCGATGCGCCACGGCACCCTGCCGAAGACCCTCCACGCCGAC
GAGCCGAGCCCGCACGTCGACTGGGCGAACAGCGGCCTGGCCCTCGTCACCGAGCCGATC
GACTGGCCGGCCGGCACCGGTCCGCGCCGCGCCGCCGTCTCCTCCTTCGGCATCAGCGGG
ACGAACGCGCACGTCGTGCTGGAGCAGGCGCCGGATGCTGCTGGTGAGGTGCTTGGGGCC
GATGAGGTGCCTGAGGTGTCTGAGACGGTAGCGATGGCTGGGACGGCTGGGACCTCCGAG
GTCGCTGAGGGCTCTGAGGCCTCCGAGGCCCCCGCGGCCCCCGGCAGCCGTGAGGCGTCC
CTCCCCGGGCACCTGCCCTGGGTGCTGTCCGCCAAGGACGAGCAGTCGCTGCGCGGCCAG
GCCGCCGCCCTGCACGCGTGGCTGTCCGAGCCCGCCGCCGACCTGTCGGACGCGGACGGA
CCGGCCCGCCTGCGGGACGTCGGGTACACGCTCGCCACGAGCCGTACCGCCTTCGCGCAC
CGCGCCGCCGTGACCGCCGCCGACCGGGACGGGTTCCTGGACGGGCTGGCCACGCTGGCC
CAGGGCGGCACCTCGGCCCACGTCCACCTGGACACCGCCCGGGACGGCACCACCGCGTTC
CTCTTCACCGGCCAGGGCAGTCAGCGCCCCGGCGCCGGCCGTGAGCTGTACGACCGGCAC
CCCGTCTTCGCCCGGGCGCTCGACGAGATCTGCGCCCACCTCGACGGTCACCTCGAACTG
CCCCTGCTCGACGTGATGTTCGCGGCCGAGGGCAGCGCGGAGGCCGCGCTGCTCGACGAG
ACGCGGTACACGCAGTGCGCGCTGTTCGCCCTGGAGGTCGCGCTCTTCCGGCTCGTCGAG
AGCTGGGGCATGCGGCCGGCCGCACTGCTCGGTCACTCGGTCGGCGAGATCGCCGCCGCG
CACGTCGCCGGTGTGTTCTCGCTCGCCGACGCCGCCCGCCTGGTCGCCGCGCGCGGCCGG
CTCATGCAGGAGCTGCCCGCCGGTGGCGCGATGCTCGCCGTCCAGGCCGCGGAGGACGAG
ATCCGCGTGTGGCTGGAGACGGAGGAGCGGTACGCGGGACGTCTGGACGTCGCCGCCGTC
AACGGCCCCGAGGCCGCCGTCCTGTCCGGCGACGCGGACGCGGCGCGGGAGGCGGAGGCG
TACTGGTCCGGGCTCGGCCGCAGGACCCGCGCGCTGCGGGTCAGCCACGCCTTCCACTCC
GCGCACATGGACGGCATGCTCGACGGGTTCCGCGCCGTCCTGGAGACGGTGGAGTTCCGG
CGCCCCTCCCTGACCGTGGTCTCGAACGTCACCGGCCTGGCCGCCGGCCCGGACGACCTG
TGCGACCCCGAGTACTGGGTCCGGCACGTCCGCGGCACCGTCCGCTTCCTCGACGGCGTC
CGTGTCCTGCGCGACCTCGGCGTGCGGACCTGCCTGGAGCTGGGCCCCGACGGGGTCCTC
ACCGCCATGGCGGCCGACGGCCTCGCGGACACCCCCGCGGATTCCGCTGCCGGCTCCCCC
GTCGGCTCTCCCGCCGGCTCTCCCGCCGACTCCGCCGCCGGCGCGCTCCGGCCCCGGCCG
CTGCTCGTGGCGCTGCTGCGCCGCAAGCGGTCGGAGACCGAGACCGTCGCGGACGCCCTC
GGCAGGGCGCACGCCCACGGCACCGGACCCGACTGGCACGCCTGGTTCGCCGGCTCCGGG
GCGCACCGCGTGGACCTGCCCACGTACTCCTTCCGGCGCGACCGCTACTGGCTGGACGCC
CCGGCGGCCGACACCGCGGTGGACACCGCCGGCCTCGGTCTCGGCACCGCCGACCACCCG
CTGCTCGGCGCCGTGGTCAGCCTTCCGGACCGGGACGGCCTGCTGCTCACCGGCCGCCTC
TCCCTGCGCACCCACCCGTGGCTCGCGGACCACGCCGTCCTGGGGAGCGTCCTGCTCCCC
GGCGCCGCGATGGTCGAACTCGCCGCGCACGCTGCGGAGTCCGCCGGTCTGCGTGACGTG
CGGGAGCTGACCCTCCTTGAACCGCTGGTACTGCCCGAGCACGGTGGCGTCGAGCTGCGC
GTGACGGTCGGGGCGCCGGCCGGAGAGCCCGGTGGCGAGTCGGCCGGGGACGGCGCACGG
CCCGTCTCCCTCCACTCGCGGCTCGCCGACGCGCCCGCCGGTACCGCCTGGTCCTGCCAC
GCGACCGGTCTGCTGGCCACCGACCGGCCCGAGCTTCCCGTCGCGCCCGACCGTGCGGCC
ATGTGGCCGCCGCAGGGCGCCGAGGAGGTGCCGCTCGACGGTCTCTACGAGCGGCTCGAC
GGGAACGGCCTCGCCTTCGGTCCGCTGTTCCAGGGGCTGAACGCGGTGTGGCGGTACGAG
GGTGAGGTCTTCGCCGACATCGCGCTCCCCGCCACCACGAATGCGACCGCGCCCGCGACC
GCGAACGGCGGCGGGAGTGCGGCGGCGGCCCCCTACGGCATCCACCCCGCCCTGCTCGAC
GCTTCGCTGCACGCCATCGCGGTCGGCGGTCTCGTCGACGAGCCCGAGCTCGTCCGCGTC
CCCTTCCACTGGAGCGGTGTCACCGTGCACGCGGCCGGTGCCGCGGCGGCCCGGGTCCGT
CTCGCCTCCGCGGGGACGGACGCCGTCTCGCTGTCCCTGACGGACGGCGAGGGACGCCCG
CTGGTCTCCGTGGAACGGCTCACGCTGCGCCCGGTCACCGCCGATCAGGCGGCGGCGAGC
CGCGTCGGCGGGCTGATGCACCGGGTGGCCTGGCGTCCGTACGCCCTCGCCTCGTCCGGC
GAACAGGACCCGCACGCCACTTCGTACGGGCCGACCGCCGTCCTCGGCAAGGACGAGCTG
AAGGTCGCCGCCGCCCTGGAGTCCGCGGGCGTCGAAGTCGGGCTCTACCCCGACCTGGCC
GCGCTGTCCCAGGACGTGGCGGCCGGCGCCCCGGCGCCCCGTACCGTCCTTGCGCCGCTG
CCCGCGGGTCCCGCCGACGGCGGCGCGGAGGGTGTACGGGGCACGGTGGCCCGGACGCTG
GAGCTGCTCCAGGCCTGGCTGGCCGACGAGCACCTCGCGGGCACCCGCCTGCTCCTGGTC
ACCCGCGGTGCGGTGCGGGACCCCGAGGGGTCCGGCGCCGACGATGGCGGCGAGGACCTG
TCGCACGCGGCCGCCTGGGGTCTCGTACGGACCGCGCAGACCGAGAACCCCGGCCGCTTC
GGCCTTCTCGACCTGGCCGACGACGCCTCGTCGTACCGGACCCTGCCGTCGGTGCTCTCC
GACGCGGGCCTGCGCGACGAACCGCAGCTCGCCCTGCACGACGGCACCATCAGGCTGGCC
CGCCTGGCCTCCGTCCGGCCCGAGACCGGCACCGCCGCACCGGCGCTCGCCCCGGAGGGC
ACGGTCCTGCTGACCGGCGGCACCGGCGGCCTGGGCGGACTGGTCGCCCGGCACGTGGTG
GGCGAGTGGGGCGTACGACGCCTGCTGCTGGTGAGCCGGCGGGGCACGGACGCCCCGGGC
GCCGACGAGCTCGTGCACGAGCTGGAGGCCCTGGGAGCCGACGTCTCGGTGGCCGCGTGC
GACGTCGCCGACCGCGAAGCCCTCACCGCCGTACTCGACGCCATCCCCGCCGAACACCCG
CTCACCGCGGTCGTCCACACGGCAGGCGTCCTCTCCGACGGCACCCTCCCGTCCATGACG
ACGGAGGACGTGGAACACGTACTGCGGCCCAAGGTCGACGCCGCGTTCCTCCTCGACGAA
CTCACCTCGACGCCCGCATACGACCTGGCAGCGTTCGTCATGTTCTCCTCCGCCGCCGCC
GTCTTCGGTGGCGCGGGGCAGGGCGCCTACGCCGCCGCCAACGCCACCCTCGACGCCCTC
GCCTGGCGCCGCCGGGCAGCCGGACTCCCCGCCCTCTCCCTCGGCTGGGGCCTCTGGGCC
GAGACCAGCGGCATGACCGGCGAGCTCGGCCAGGCGGACCTGCGCCGGATGAGCCGCGCG
GGCATCGGCGGGATCAGCGACGCCGAGGGCATCGCGCTCCTCGACGCCGCCCTCCGCGAC
GACCGCCACCCGGTCCTGCTGCCCCTGCGGCTCGACGCCGCCGGGCTGCGGGACGCGGCC
GGGAACGACCCGGCCGGAATCCCGGCGCTCTTCCGGGACGTCGTCGGCGCCAGGACCGTC
CGGGCCCGGCCGTCCGCGGCCTCCGCCTCGACGACAGCCGGGACGGCCGGCACGCCGGGG
ACGGCGGACGGCGCGGCGGAAACGGCGGCGGTCACGCTCGCCGACCGGGCCGCCACCGTG
GACGGGCCCGCACGGCAGCGCCTGCTGCTCGAGTTCGTCGTCGGCGAGGTCGCCGAAGTA
CTCGGCCACGCCCGCGGTCACCGGATCGACGCCGAACGGGGCTTCCTCGACCTCGGCTTC
GACTCCCTGACCGCCGTCGAACTCCGCAACCGGCTCAACTCCGCCGGTGGCCTCGCCCTC
CCGGCGACCCTGGTCTTCGACCACCCAAGCCCGGCGGCACTCGCCTCCCACCTGGACGCC
GAGCTGCCGCGCGGCGCCTCGGACCAGGACGGAGCCGGGAACCGGAACGGGAACGAGAAC
GGGACGACGGCGTCCCGGAGCACCGCCGAGACGGACGCGCTGCTGGCACAACTGACCCGC
CTGGAAGGCGCCTTGGTGCTGACGGGCCTCTCGGACGCCCCCGGGAGCGAAGAAGTCCTG
GAGCACCTGCGGTCCCTGCGCTCGATGGTCACGGGCGAGACCGGGACCGGGACCGCGTCC
GGAGCCCCGGACGGCGCCGGGTCCGGCGCCGAGGACCGGCCCTGGGCGGCCGGGGACGGA
GCCGGGGGCGGGAGTGAGGACGGCGCGGGAGTGCCGGACTTCATGAACGCCTCGGCCGAG
GAACTCTTCGGCCTCCTCGACCAGGACCCCAGCACGGACTGA
[0] KSQ89..464
[0] AT634..943
[0] methylmalonyl-CoA824..828
[0] ACP1012..1082
[1] KS1108..1485
[1] AT1650..1960
[1] methylmalonyl-CoA1840..1844
[1] KR2208..2387
[1] ACP2497..2567
[2] KS2604..2979
[2] AT3180..3527
[2] malonyl-CoA3376..3380
[2] DH3579..3753
[2] KR4100..4282
[2] ACP4409..4479
[0] KSQ265..1392
[0] AT1900..2829
[0] methylmalonyl-CoA2470..2484
[0] ACP3034..3246
[1] KS3322..4455
[1] AT4948..5880
[1] methylmalonyl-CoA5518..5532
[1] KR6622..7161
[1] ACP7489..7701
[2] KS7810..8937
[2] AT9538..10581
[2] malonyl-CoA10126..10140
[2] DH10735..11259
[2] KR12298..12846
[2] ACP13225..13437

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [627-756]  G3DSA:3.40.366.10 [824-933]  G3DSA:3.40.366.10 [1640-1772]  G3DSA:3.40.366.10 [1840-1950]  G3DSA:3.40.366.10 [3172-3305]  G3DSA:3.40.366.10 [3376-3518]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [2525-2540]  PS00012 [4437-4452]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1005-1125]  6.09999977126211e-23 SSF47336 [2490-2620]  2.70000183580794e-25 SSF47336 [4401-4496]  1.79999754022375e-22 SSF47336
SSF47336   ACP_like
 [1012-1081]  3.60000000000002e-60 G3DSA:1.10.1200.10 [2497-2569]  3.60000000000002e-60 G3DSA:1.10.1200.10 [4407-4482]  3.60000000000002e-60 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1012-1082]  PS50075 [2497-2567]  PS50075 [4409-4479]  PS50075
PS50075   ACP_DOMAIN
 [1014-1080]  1.9e-09 PF00550 [2501-2565]  3.2e-10 PF00550 [4413-4478]  2e-12 PF00550
PF00550   PP-binding
IPR013968 Polyketide synthase, KR (Domain)
 [2208-2386]  5.40000000000002e-62 PF08659 [4100-4281]  1e-57 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [89-338]  1.9e-92 PF00109 [1108-1359]  8.49999999999995e-100 PF00109 [2604-2854]  7.20000000000003e-98 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [346-464]  7.29999999999998e-41 PF02801 [1367-1485]  1.2e-48 PF02801 [2862-2979]  1.70000000000001e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [634-943]  1.99999999999999e-99 PF00698 [1650-1960]  2.79999999999994e-100 PF00698 [3180-3527]  2.4e-60 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [631-937]  3.29999077503323e-62 SSF52151 [1647-1939]  4.90001027782408e-62 SSF52151 [3177-3475]  1.69998802370953e-69 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [759-823]  4.00000300869883e-17 SSF55048 [1775-1839]  4.90001027782405e-17 SSF55048 [3307-3375]  5.40000570248859e-15 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [89-349]  G3DSA:3.40.47.10 [350-517]  G3DSA:3.40.47.10 [1108-1370]  G3DSA:3.40.47.10 [1371-1538]  G3DSA:3.40.47.10 [2604-2865]  G3DSA:3.40.47.10 [2866-3032]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [81-518]  2.39999798157263e-97 SSF53901 [1108-1536]  4.99996518094122e-108 SSF53901 [2603-3032]  8.29994113369276e-104 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [2208-2388]  3.99999999999998e-66 G3DSA:3.40.50.720 [4100-4285]  3.99999999999998e-66 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1272-1288]  PS00606 [2767-2783]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [635-926]  5.6999970878395e-118 SM00827 [1651-1942]  2.89997807423187e-115 SM00827 [3181-3510]  2.2999842048857e-119 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1013-1085]  7.79998304125571e-25 SM00823 [2498-2570]  2.30000440726534e-30 SM00823 [4410-4482]  1e-32 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [3579-3753]  4.60000044330866e-77 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [91-518]  SM00825 [1111-1539]  SM00825 [2606-3032]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2208-2387]  4.90001027782408e-55 SM00822 [4100-4282]  2.30000440726534e-56 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit