close all open/close all

CDS information : Pikro_00040


close this sectionLocation

Organism
StrainATCC 15439
Entry namePikromycin
Contig
Start / Stop / Direction16,858 / 28,077 / + [in whole cluster]
16,858 / 28,077 / + [in contig]
Location16858..28077 [in whole cluster]
16858..28077 [in contig]
TypeCDS
Length11,220 bp (3,739 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I polyketide synthase PikAII
Gene
Gene (GenBank)pikAII
EC number
Keyword
Note
Note (GenBank)
  • multifunctional polyketide synthase; contains Pik module 3 and module 4
Reference
ACC
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[10421766] Elucidating the mechanism of chain termination switching in the picromycin/methymycin polyketide synthase. (Chem Biol. , 1999)
[10662693] Formation of functional heterologous complexes using subunits from the picromycin, erythromycin and oleandomycin polyketide synthases. (Chem Biol. , 2000)
[10713461] Genetic architecture of the polyketide synthases for methymycin and pikromycin series macrolides. (Gene. , 2000)
[25004372] Elucidation of the cryptic epimerase activity of redox-inactive ketoreductase domains from modular polyketide synthases by tandem equilibrium isotope exchange. (J Am Chem Soc. , 2014)
[26863427] Epimerase and Reductase Activities of Polyketide Synthase Ketoreductase Domains Utilize the Same Conserved Tyrosine and Serine Residues. (Biochemistry. , 2016)

close this sectionPKS/NRPS Module

3 methylmalonyl-CoA
4 methylmalonyl-CoA
KS36..412
AT572..881
kr1150..1345
ACP1443..1517
KS1539..1916
AT2069..2379
DH2428..2593
ER2959..3267
KR3277..3459
ACP3572..3642

close this sectionSequence

selected fasta
>polyketide synthase [type I polyketide synthase PikAII]
MSTVNEEKYLDYLRRATADLHEARGRLRELEAKAGEPVAIVGMACRLPGGVASPEDLWRL
VAGGEDAISEFPQDRGWDVEGLYDPNPEATGKSYAREAGFLYEAGEFDADFFGISPREAL
AMDPQQRLLLEASWEAFEHAGIPAATARGTSVGVFTGVMYHDYATRLTDVPEGIEGYLGT
GNSGSVASGRVAYTLGLEGPAVTVDTACSSSLVALHLAVQALRKGEVDMALAGGVTVMST
PSTFVEFSRQRGLAPDGRSKSFSSTADGTSWSEGVGVLLVERLSDARRKGHRILAVVRGT
AVNQDGASSGLTAPNGPSQQRVIRRALADARLTTSDVDVVEAHGTGTRLGDPIEAQAVIA
TYGQGRDGEQPLRLGSLKSNIGHTQAAAGVSGVIKMVQAMRHGVLPKTLHVEKPTDQVDW
SAGAVELLTEAMDWPDKGDGGLRRAAVSSFGVSGTNAHVVLEEAPAAEETPASEATPAVE
PSVGAGLVPWLVSAKTPAALDAQIGRLAAFASQGRTDAADPGAVARVLAGGRAEFEHRAV
VLGTGQDDFAQALTAPEGLIRGTPSDVGRVAFVFPGQGTQWAGMGAELLDVSKEFAAAMA
ECESALSRYVDWSLEAVVRQAPGAPTLERVDVVQPVTFAVMVSLAKVWQHHGVTPQAVVG
HSQGEIAAAYVAGALTLDDAARVVTLRSKSIAAHLAGKGGMISLALSEEATRQRIENLHG
LSIAAVNGPTATVVSGDPTQIQELAQACEADGVRARIIPVDYASHSAHVETIESELAEVL
AGLSPRTPEVPFFSTLEGAWITEPVLDGTYWYRNLRHRVGFAPAVETLATDEGFTHFIEV
SAHPVLTMTLPETVTGLGTLRREQGGQERLVTSLAEAWTNGLTIDWAPVLPTATGHHPEL
PTYAFQRRHYWLHDSPAVQGSVQDSWRYRIDWKRLAVADASERAGLSGRWLVVVPEDRSA
EAAPVLAALSGAGADPVQLDVSPLGDRQRLAATLGEALAAAGGAVDGVLSLLAWDESAHP
GHPAPFTRGTGATLTLVQALEDAGVAAPLWCVTHGAVSVGRADHVTSPAQAMVWGMGRVA
ALEHPERWGGLIDLPSDADRAALDRMTTVLAGGTGEDQVAVRASGLLARRLVRASLPAHG
TASPWWQADGTVLVTGAEEPAAAEAARRLARDGAGHLLLHTTPSGSEGAEGTSGAAEDSG
LAGLVAELADLGATATVVTCDLTDAEAAARLLAGVSDAHPLSAVLHLPPTVDSEPLAATD
ADALARVVTAKATAALHLDRLLREAAAAGGRPPVLVLFSSVAAIWGGAGQGAYAAGTAFL
DALAGQHRADGPTVTSVAWSPWEGSRVTEGATGERLRRLGLRPLAPATALTALDTALGHG
DTAVTIADVDWSSFAPGFTTARPGTLLADLPEARRALDEQQSTTAADDTVLSRELGALTG
AEQQRRMQELVREHLAVVLNHPSPEAVDTGRAFRDLGFDSLTAVELRNRLKNATGLALPA
TLVFDYPTPRTLAEFLLAEILGEQAGAGEQLPVDGGVDDEPVAIVGMACRLPGGVASPED
LWRLVAGGEDAISGFPQDRGWDVEGLYDPDPDASGRTYCRAGGFLDEAGEFDADFFGISP
REALAMDPQQRLLLETSWEAVEDAGIDPTSLQGQQVGVFAGTNGPHYEPLLRNTAEDLEG
YVGTGNAASIMSGRVSYTLGLEGPAVTVDTACSSSLVALHLAVQALRKGECGLALAGGVT
VMSTPTTFVEFSRQRGLAEDGRSKAFAASADGFGPAEGVGMLLVERLSDARRNGHRVLAV
VRGSAVNQDGASNGLTAPNGPSQQRVIRRALADARLTTADVDVVEAHGTGTRLGDPIEAQ
ALIATYGQGRDTEQPLRLGSLKSNIGHTQAAAGVSGIIKMVQAMRHGVLPKTLHVDRPSD
QIDWSAGTVELLTEAMDWPRKQEGGLRRAAVSSFGISGTNAHIVLEEAPVDEDAPADEPS
VGGVVPWLVSAKTPAALDAQIGRLAAFASQGRTDAADPGAVARVLAGGRAQFEHRAVALG
TGQDDLAAALAAPEGLVRGVASGVGRVAFVFPGQGTQWAGMGAELLDVSKEFAAAMAECE
AALAPYVDWSLEAVVRQAPGAPTLERVDVVQPVTFAVMVSLAKVWQHHGVTPQAVVGHSQ
GEIAAAYVAGALSLDDAARVVTLRSKSIGAHLAGQGGMLSLALSEAAVVERLAGFDGLSV
AAVNGPTATVVSGDPTQIQELAQACEADGVRARIIPVDYASHSAHVETIESELADVLAGL
SPQTPQVPFFSTLEGAWITEPALDGGYWYRNLRHRVGFAPAVETLATDEGFTHFVEVSAH
PVLTMALPETVTGLGTLRRDNGGQHRLTTSLAEAWANGLTVDWASLLPTTTTHPDLPTYA
FQTERYWPQPDLSAAGDITSAGLGAAEHPLLGAAVALADSDGCLLTGSLSLRTHPWLADH
AVAGTVLLPGTAFVELAFRAGDQVGCDLVEELTLDAPLVLPRRGAVRVQLSVGASDESGR
RTFGLYAHPEDAPGEAEWTRHATGVLAARADRTAPVADPEAWPPPGAEPVDVDGLYERFA
ANGYGYGPLFQGVRGVWRRGDEVFADVALPAEVAGAEGARFGLHPALLDAAVQAAGAGRG
VRRGHAAAVRLERDLLYAVGATALRVRLAPAGPDTVSVSAADSSGQPVFAADSLTVLPVD
PAQLAAFSDPTLDALHLLEWTAWDGAAQALPGAVVLGGDADGLAAALRAGGTEVLSFPDL
TDLVEAVDRGETPAPATVLVACPAAGPDGPEHVREALHGSLALMQAWLADERFTDGRLVL
VTRDAVAARSGDGLRSTGQAAVWGLGRSAQTESPGRFVLLDLAGEARTAGDATAGDGLTT
GDATVGGTSGDAALGSALATALGSGEPQLALRDGALLVPRLARAAAPAAADGLAAADGLA
ALPLPAAPALWRLEPGTDGSLESLTAAPGDAETLAPEPLGPGQVRIAIRATGLNFRDVLI
ALGMYPDPALMGTEGAGVVTATGPGVTHLAPGDRVMGLLSGAYAPVVVADARTVARMPEG
WTFAQGASVPVVFLTAVYALRDLADVKPGERLLVHSAAGGVGMAAVQLARHWGVEVHGTA
SHGKWDALRALGLDDAHIASSRTLDFESAFRAASGGAGMDVVLNSLAREFVDASLRLLGP
GGRFVEMGKTDVRDAERVAADHPGVGYRAFDLGEAGPERIGEMLAEVIALFEDGVLRHLP
VTTWDVRRARDAFRHVSQARHTGKVVLTMPSGLDPEGTVLLTGGTGALGGIVARHVVGEW
GVRRLLLVSRRGTDAPGAGELVHELEALGADVSVAACDVADREALTAVLDSIPAEHPLTA
VVHTAGVLSDGTLPSMTAEDVEHVLRPKVDAAFLLDELTSTPGYDLAAFVMFSSAAAVFG
GAGQGAYAAANATLDALAWRRRTAGLPALSLGWGLWAETSGMTGGLSDTDRSRLARSGAT
PMDSELTLSLLDAAMRRDDPALVPIALDVAALRAQQRDGMLAPLLSGLTRGSRVGGAPVN
QRRAAAGGAGEADTDLGGRLAAMTPDDRVAHLRDLVRTHVATVLGHGTPSRVDLERAFRD
TGFDSLTAVELRNRLNAATGLRLPATLVFDHPTPGELAGHLLDELATAAGGSWAEGTGSG
DTASATDRQTTAALAELDRLEGVLASLAPAAGGRPELAARLRALAAALGDDGDDATDLDE
ASDDDLFSFIDKELGDSDF
selected fasta
>polyketide synthase [type I polyketide synthase PikAII]
GTGTCCACGGTGAACGAAGAGAAGTACCTCGACTACCTGCGTCGTGCCACGGCGGACCTC
CACGAGGCCCGTGGCCGCCTCCGCGAGCTGGAGGCGAAGGCGGGCGAGCCGGTGGCGATC
GTCGGCATGGCCTGCCGCCTGCCCGGCGGCGTCGCCTCGCCCGAGGACCTGTGGCGGCTG
GTGGCCGGCGGCGAGGACGCGATCTCGGAGTTCCCCCAGGACCGCGGCTGGGACGTGGAG
GGCCTGTACGACCCGAACCCGGAGGCCACGGGCAAGAGTTACGCCCGCGAGGCCGGATTC
CTGTACGAGGCGGGCGAGTTCGACGCCGACTTCTTCGGGATCTCGCCGCGCGAGGCCCTC
GCCATGGACCCGCAGCAGCGTCTCCTCCTGGAGGCCTCCTGGGAGGCGTTCGAGCACGCC
GGGATCCCGGCGGCCACCGCGCGCGGCACCTCGGTCGGCGTCTTCACCGGCGTGATGTAC
CACGACTACGCCACCCGTCTCACCGATGTCCCGGAGGGCATCGAGGGCTACCTGGGCACC
GGCAACTCCGGCAGTGTCGCCTCGGGCCGCGTCGCGTACACGCTTGGCCTGGAGGGGCCG
GCCGTCACGGTCGACACCGCCTGCTCGTCCTCGCTGGTCGCCCTGCACCTCGCCGTGCAG
GCCCTGCGCAAGGGCGAGGTCGACATGGCGCTCGCCGGCGGCGTGACGGTCATGTCGACG
CCCAGCACCTTCGTCGAGTTCAGCCGTCAGCGCGGGCTGGCGCCGGACGGCCGGTCGAAG
TCCTTCTCGTCGACGGCCGACGGCACCAGCTGGTCCGAGGGCGTCGGCGTCCTCCTCGTC
GAGCGCCTGTCCGACGCGCGTCGCAAGGGCCATCGGATCCTCGCCGTGGTCCGGGGCACC
GCCGTCAACCAGGACGGCGCCAGCAGCGGCCTCACGGCTCCGAACGGGCCGTCGCAGCAG
CGCGTCATCCGACGTGCCCTGGCGGACGCCCGGCTCACGACCTCCGACGTGGACGTCGTC
GAGGCCCACGGCACGGGTACGCGACTCGGCGACCCGATCGAGGCGCAGGCCGTCATCGCC
ACGTACGGGCAGGGCCGTGACGGCGAACAGCCGCTGCGCCTCGGGTCGTTGAAGTCCAAC
ATCGGACACACCCAGGCCGCCGCCGGTGTCTCCGGCGTGATCAAGATGGTCCAGGCGATG
CGCCACGGCGTCCTGCCGAAGACGCTCCACGTGGAGAAGCCGACGGACCAGGTGGACTGG
TCCGCGGGCGCGGTCGAGCTGCTCACCGAGGCCATGGACTGGCCGGACAAGGGCGACGGC
GGACTGCGCAGGGCCGCGGTCTCCTCCTTCGGCGTCAGCGGGACGAACGCGCACGTCGTG
CTCGAAGAGGCCCCGGCGGCCGAGGAGACCCCTGCCTCCGAGGCGACCCCGGCCGTCGAG
CCGTCGGTCGGCGCCGGCCTGGTGCCGTGGCTGGTGTCGGCGAAGACTCCGGCCGCGCTG
GACGCCCAGATCGGACGCCTCGCCGCGTTCGCCTCGCAGGGCCGTACGGACGCCGCCGAT
CCGGGCGCGGTCGCTCGCGTACTGGCCGGCGGGCGCGCCGAGTTCGAGCACCGGGCCGTC
GTGCTCGGCACCGGACAGGACGATTTCGCGCAGGCGCTGACCGCTCCGGAAGGACTGATA
CGCGGCACGCCCTCGGACGTGGGCCGGGTGGCGTTCGTGTTCCCCGGTCAGGGCACGCAG
TGGGCCGGGATGGGCGCCGAACTCCTCGACGTGTCGAAGGAGTTCGCGGCGGCCATGGCC
GAGTGCGAGAGCGCGCTCTCCCGCTATGTCGACTGGTCGCTGGAGGCCGTCGTCCGGCAG
GCGCCGGGCGCGCCCACGCTGGAGCGGGTCGACGTCGTCCAGCCCGTGACCTTCGCTGTC
ATGGTTTCGCTGGCGAAGGTCTGGCAGCACCACGGCGTGACGCCGCAGGCCGTCGTCGGC
CACTCGCAGGGCGAGATCGCCGCCGCGTACGTCGCCGGTGCCCTCACCCTCGACGACGCC
GCCCGCGTCGTCACCCTGCGCAGCAAGTCCATCGCCGCCCACCTCGCCGGCAAGGGCGGC
ATGATCTCCCTCGCCCTCAGCGAGGAAGCCACCCGGCAGCGCATCGAGAACCTCCACGGA
CTGTCGATCGCCGCCGTCAACGGCCCCACCGCCACCGTGGTTTCGGGCGACCCCACCCAG
ATCCAAGAGCTCGCTCAGGCGTGTGAGGCCGACGGGGTCCGCGCACGGATCATCCCCGTC
GACTACGCCTCCCACAGCGCCCACGTCGAGACCATCGAGAGCGAACTCGCCGAGGTCCTC
GCCGGGCTCAGCCCGCGGACACCTGAGGTGCCGTTCTTCTCGACACTCGAAGGCGCCTGG
ATCACCGAGCCGGTGCTCGACGGCACCTACTGGTACCGCAACCTCCGCCACCGCGTCGGC
TTCGCCCCCGCCGTCGAGACCCTCGCCACCGACGAAGGCTTCACCCACTTCATCGAGGTC
AGCGCCCACCCCGTCCTCACCATGACCCTCCCCGAGACCGTCACCGGCCTCGGCACCCTC
CGCCGCGAACAGGGAGGCCAGGAGCGTCTGGTCACCTCACTCGCCGAAGCCTGGACCAAC
GGCCTCACCATCGACTGGGCGCCCGTCCTCCCCACCGCAACCGGCCACCACCCCGAGCTC
CCCACCTACGCCTTCCAGCGCCGTCACTACTGGCTCCACGACTCCCCCGCCGTCCAGGGC
TCCGTGCAGGACTCCTGGCGCTACCGCATCGACTGGAAGCGCCTCGCGGTCGCCGACGCG
TCCGAGCGCGCCGGGCTGTCCGGGCGCTGGCTCGTCGTCGTCCCCGAGGACCGTTCCGCC
GAGGCCGCCCCGGTGCTCGCCGCGCTGTCCGGCGCCGGCGCCGACCCCGTACAGCTGGAC
GTGTCCCCGCTGGGCGACCGGCAGCGGCTCGCCGCGACGCTGGGCGAGGCCCTGGCGGCG
GCCGGTGGAGCCGTCGACGGCGTCCTCTCGCTGCTCGCGTGGGACGAGAGCGCGCACCCC
GGCCACCCCGCCCCCTTCACCCGGGGCACCGGCGCCACCCTCACCCTGGTGCAGGCGCTG
GAGGACGCCGGCGTCGCCGCCCCGCTGTGGTGCGTGACCCACGGCGCGGTGTCCGTCGGC
CGGGCCGACCACGTCACCTCCCCCGCCCAGGCCATGGTGTGGGGCATGGGCCGGGTCGCC
GCCCTGGAGCACCCCGAGCGGTGGGGCGGCCTGATCGACCTGCCCTCGGACGCCGACCGG
GCGGCCCTGGACCGCATGACCACGGTCCTCGCCGGCGGTACGGGTGAGGACCAGGTCGCG
GTACGCGCCTCCGGGCTGCTCGCCCGCCGCCTCGTCCGCGCCTCCCTCCCGGCGCACGGC
ACGGCTTCGCCGTGGTGGCAGGCCGACGGCACGGTGCTCGTCACCGGTGCCGAGGAGCCT
GCGGCCGCCGAGGCCGCACGCCGGCTGGCCCGCGACGGCGCCGGACACCTCCTCCTCCAC
ACCACCCCCTCCGGCAGCGAAGGCGCCGAAGGCACCTCCGGTGCCGCCGAGGACTCCGGC
CTCGCCGGGCTCGTCGCCGAACTCGCGGACCTGGGCGCGACGGCCACCGTCGTGACCTGC
GACCTCACGGACGCGGAGGCGGCCGCCCGGCTGCTCGCCGGCGTCTCCGACGCGCACCCG
CTCAGCGCCGTCCTCCACCTGCCGCCCACCGTCGACTCCGAGCCGCTCGCCGCGACCGAC
GCGGACGCGCTCGCCCGTGTCGTGACCGCGAAGGCCACCGCCGCGCTCCACCTGGACCGC
CTCCTGCGGGAGGCCGCGGCTGCCGGAGGCCGTCCGCCCGTCCTGGTCCTCTTCTCCTCG
GTCGCCGCGATCTGGGGCGGCGCCGGTCAGGGCGCGTACGCCGCCGGTACGGCCTTCCTC
GACGCCCTCGCCGGTCAGCACCGGGCCGACGGCCCCACCGTGACCTCGGTGGCCTGGAGC
CCCTGGGAGGGCAGCCGCGTCACCGAGGGTGCGACCGGGGAGCGGCTGCGCCGCCTCGGC
CTGCGCCCCCTCGCCCCCGCGACGGCGCTCACCGCCCTGGACACCGCGCTCGGCCACGGC
GACACCGCCGTCACGATCGCCGACGTCGACTGGTCGAGCTTCGCCCCCGGCTTCACCACG
GCCCGGCCGGGCACCCTCCTCGCCGATCTGCCCGAGGCGCGCCGCGCGCTCGACGAGCAG
CAGTCGACGACGGCCGCCGACGACACCGTCCTGAGCCGCGAGCTCGGTGCGCTCACCGGC
GCCGAACAGCAGCGCCGTATGCAGGAGTTGGTCCGCGAGCACCTCGCCGTGGTCCTCAAC
CACCCCTCCCCCGAGGCCGTCGACACGGGGCGGGCCTTCCGTGACCTCGGATTCGACTCG
CTGACGGCGGTCGAGCTCCGCAACCGCCTCAAGAACGCCACCGGCCTGGCCCTCCCGGCC
ACTCTGGTCTTCGACTACCCGACCCCCCGGACGCTGGCGGAGTTCCTCCTCGCGGAGATC
CTGGGCGAGCAGGCCGGTGCCGGCGAGCAGCTTCCGGTGGACGGCGGGGTCGACGACGAG
CCCGTCGCGATCGTCGGCATGGCGTGCCGCCTGCCGGGCGGTGTCGCCTCGCCGGAGGAC
CTGTGGCGGCTGGTGGCCGGCGGCGAGGACGCGATCTCCGGCTTCCCGCAGGACCGCGGC
TGGGACGTGGAGGGGCTGTACGACCCGGACCCGGACGCGTCCGGGCGGACGTACTGCCGT
GCCGGTGGCTTCCTCGACGAGGCGGGCGAGTTCGACGCCGACTTCTTCGGGATCTCGCCG
CGCGAGGCCCTCGCCATGGACCCGCAGCAGCGGCTCCTCCTGGAGACCTCCTGGGAGGCC
GTCGAGGACGCCGGGATCGACCCGACCTCCCTTCAGGGGCAGCAGGTCGGCGTGTTCGCG
GGCACCAACGGCCCCCACTACGAGCCGCTGCTCCGCAACACCGCCGAGGATCTTGAGGGT
TACGTCGGGACGGGCAACGCCGCCAGCATCATGTCGGGCCGTGTCTCGTACACCCTCGGC
CTGGAGGGCCCGGCCGTCACGGTCGACACCGCCTGCTCCTCCTCGCTGGTCGCCCTGCAC
CTCGCCGTGCAGGCCCTGCGCAAGGGCGAATGCGGACTGGCGCTCGCGGGCGGTGTGACG
GTCATGTCGACGCCCACGACGTTCGTGGAGTTCAGCCGGCAGCGCGGGCTCGCGGAGGAC
GGCCGGTCGAAGGCGTTCGCCGCGTCGGCGGACGGCTTCGGCCCGGCGGAGGGCGTCGGC
ATGCTCCTCGTCGAGCGCCTGTCGGACGCCCGCCGCAACGGACACCGTGTGCTGGCGGTC
GTGCGCGGCAGCGCGGTCAACCAGGACGGCGCGAGCAACGGCCTGACCGCCCCGAACGGG
CCCTCGCAGCAGCGCGTCATCCGGCGCGCGCTCGCGGACGCCCGACTGACGACCGCCGAC
GTGGACGTCGTCGAGGCCCACGGCACGGGCACGCGACTCGGCGACCCGATCGAGGCACAG
GCCCTCATCGCCACCTACGGCCAGGGGCGCGACACCGAACAGCCGCTGCGCCTGGGGTCG
TTGAAGTCCAACATCGGACACACCCAGGCCGCCGCCGGTGTCTCCGGCATCATCAAGATG
GTCCAGGCGATGCGCCACGGCGTCCTGCCGAAGACGCTCCACGTGGACCGGCCGTCGGAC
CAGATCGACTGGTCGGCGGGCACGGTCGAGCTGCTCACCGAGGCCATGGACTGGCCGAGG
AAGCAGGAGGGCGGGCTGCGCCGCGCGGCCGTCTCCTCCTTCGGCATCAGCGGCACGAAC
GCGCACATCGTGCTCGAAGAAGCCCCGGTCGACGAGGACGCCCCGGCGGACGAGCCGTCG
GTCGGCGGTGTGGTGCCGTGGCTCGTGTCCGCGAAGACTCCGGCCGCGCTGGACGCCCAG
ATCGGACGCCTCGCCGCGTTCGCCTCGCAGGGCCGTACGGACGCCGCCGATCCGGGCGCG
GTCGCTCGCGTACTGGCCGGCGGGCGTGCGCAGTTCGAGCACCGGGCCGTCGCGCTCGGC
ACCGGACAGGACGACCTGGCGGCCGCACTGGCCGCGCCTGAGGGTCTGGTCCGGGGTGTG
GCCTCCGGTGTGGGTCGAGTGGCGTTCGTGTTCCCGGGACAGGGCACGCAGTGGGCCGGG
ATGGGTGCCGAACTCCTCGACGTGTCGAAGGAGTTCGCGGCGGCCATGGCCGAGTGCGAG
GCCGCGCTCGCTCCGTACGTGGACTGGTCGCTGGAGGCCGTCGTCCGACAGGCCCCCGGC
GCGCCCACGCTGGAGCGGGTCGATGTCGTCCAGCCCGTGACGTTCGCCGTCATGGTCTCG
CTGGCGAAGGTCTGGCAGCACCACGGGGTGACCCCGCAAGCCGTCGTCGGCCACTCGCAG
GGCGAGATCGCCGCCGCGTACGTCGCCGGTGCCCTGAGCCTGGACGACGCCGCTCGTGTC
GTGACCCTGCGCAGCAAGTCCATCGGCGCCCACCTCGCGGGCCAGGGCGGCATGCTGTCC
CTCGCGCTGAGCGAGGCGGCCGTTGTGGAGCGACTGGCCGGGTTCGACGGGCTGTCCGTC
GCCGCCGTCAACGGGCCTACCGCCACCGTGGTTTCGGGCGACCCGACCCAGATCCAAGAG
CTCGCTCAGGCGTGTGAGGCCGACGGGGTCCGCGCACGGATCATCCCCGTCGACTACGCC
TCCCACAGCGCCCACGTCGAGACCATCGAGAGCGAACTCGCCGACGTCCTGGCGGGGTTG
TCCCCCCAGACACCCCAGGTCCCCTTCTTCTCCACCCTCGAAGGCGCCTGGATCACCGAA
CCCGCCCTCGACGGCGGCTACTGGTACCGCAACCTCCGCCATCGTGTGGGCTTCGCCCCG
GCCGTCGAAACCCTGGCCACCGACGAAGGCTTCACCCACTTCGTCGAGGTCAGCGCCCAC
CCCGTCCTCACCATGGCGCTGCCCGAGACCGTCACCGGACTCGGCACCCTCCGCCGTGAC
AACGGCGGACAGCACCGCCTCACCACCTCCCTCGCCGAGGCCTGGGCCAACGGCCTCACC
GTCGACTGGGCCTCTCTCCTCCCCACCACGACCACCCACCCCGATCTGCCCACCTACGCC
TTCCAGACCGAGCGCTACTGGCCGCAGCCCGACCTCTCCGCCGCCGGTGACATCACCTCC
GCCGGTCTCGGGGCGGCCGAGCACCCGCTGCTCGGCGCGGCCGTGGCGCTCGCGGACTCC
GACGGCTGCCTGCTCACGGGGAGCCTCTCCCTCCGTACGCACCCCTGGCTGGCGGACCAC
GCGGTGGCCGGCACCGTGCTGCTGCCGGGAACGGCGTTCGTGGAGCTGGCGTTCCGAGCC
GGGGACCAGGTCGGTTGCGATCTGGTCGAGGAGCTCACCCTCGACGCGCCGCTCGTGCTG
CCCCGTCGTGGCGCGGTCCGTGTGCAGCTGTCCGTCGGCGCGAGCGACGAGTCCGGGCGT
CGTACCTTCGGGCTCTACGCGCACCCGGAGGACGCGCCGGGCGAGGCGGAGTGGACGCGG
CACGCCACCGGTGTGCTGGCCGCCCGTGCGGACCGCACCGCCCCCGTCGCCGACCCGGAG
GCCTGGCCGCCGCCGGGCGCCGAGCCGGTGGACGTGGACGGTCTGTACGAGCGCTTCGCG
GCGAACGGCTACGGCTACGGCCCCCTCTTCCAGGGCGTCCGTGGTGTCTGGCGGCGTGGC
GACGAGGTGTTCGCCGACGTGGCCCTGCCGGCCGAGGTCGCCGGTGCCGAGGGCGCGCGG
TTCGGCCTTCACCCGGCGCTGCTCGACGCCGCCGTGCAGGCGGCCGGTGCGGGCCGGGGC
GTTCGGCGCGGGCACGCGGCTGCCGTTCGCCTGGAGCGGGATCTCCTGTACGCGGTCGGC
GCCACCGCCCTCCGCGTGCGGCTGGCCCCCGCCGGCCCGGACACGGTGTCCGTGAGCGCC
GCCGACTCCTCCGGGCAGCCGGTGTTCGCCGCGGACTCCCTCACGGTGCTGCCCGTCGAC
CCCGCGCAGCTGGCGGCCTTCAGCGACCCGACTCTGGACGCGCTGCACCTGCTGGAGTGG
ACCGCCTGGGACGGTGCCGCGCAGGCCCTGCCCGGCGCGGTCGTGCTGGGCGGCGACGCC
GACGGTCTCGCCGCGGCGCTGCGCGCCGGTGGCACCGAGGTCCTGTCCTTCCCGGACCTT
ACGGACCTGGTGGAGGCCGTCGACCGGGGCGAGACCCCGGCCCCGGCGACCGTCCTGGTG
GCCTGCCCCGCCGCCGGCCCCGATGGGCCGGAGCATGTCCGCGAGGCCCTGCACGGGTCG
CTCGCGCTGATGCAGGCCTGGCTGGCCGACGAGCGGTTCACCGATGGGCGCCTGGTGCTC
GTGACCCGCGACGCGGTCGCCGCCCGTTCCGGCGACGGCCTGCGGTCCACGGGACAGGCC
GCCGTCTGGGGCCTCGGCCGGTCCGCGCAGACGGAGAGCCCGGGCCGGTTCGTCCTGCTC
GACCTCGCCGGGGAAGCCCGGACGGCCGGGGACGCCACCGCCGGGGACGGCCTGACGACC
GGGGACGCCACCGTCGGCGGCACCTCTGGAGACGCCGCCCTCGGCAGCGCCCTCGCGACC
GCCCTCGGCTCGGGCGAGCCGCAGCTCGCCCTCCGGGACGGGGCGCTCCTCGTACCCCGC
CTGGCGCGGGCCGCCGCGCCCGCCGCGGCCGACGGCCTCGCCGCGGCCGACGGCCTCGCC
GCTCTGCCGCTGCCCGCCGCTCCGGCCCTCTGGCGTCTGGAGCCCGGTACGGACGGCAGC
CTGGAGAGCCTCACGGCGGCGCCCGGCGACGCCGAGACCCTCGCCCCGGAGCCGCTCGGC
CCGGGACAGGTCCGCATCGCGATCCGGGCCACCGGTCTCAACTTCCGCGACGTCCTGATC
GCCCTCGGCATGTACCCCGATCCGGCGCTGATGGGCACCGAGGGAGCCGGCGTGGTCACC
GCGACCGGCCCCGGCGTCACGCACCTCGCCCCCGGCGACCGGGTCATGGGCCTGCTCTCC
GGCGCGTACGCCCCGGTCGTCGTGGCGGACGCGCGGACCGTCGCGCGGATGCCCGAGGGG
TGGACGTTCGCCCAGGGCGCCTCCGTGCCGGTGGTGTTCCTGACGGCCGTCTACGCCCTG
CGCGACCTGGCGGACGTCAAGCCCGGCGAGCGCCTCCTGGTCCACTCCGCCGCCGGTGGC
GTGGGCATGGCCGCCGTGCAGCTCGCCCGGCACTGGGGCGTGGAGGTCCACGGCACGGCG
AGTCACGGGAAGTGGGACGCCCTGCGCGCGCTCGGCCTGGACGACGCGCACATCGCCTCC
TCCCGCACCCTGGACTTCGAGTCCGCGTTCCGTGCCGCTTCCGGCGGGGCGGGCATGGAC
GTCGTACTGAACTCGCTCGCCCGCGAGTTCGTCGACGCCTCGCTGCGCCTGCTCGGGCCG
GGCGGCCGGTTCGTGGAGATGGGGAAGACCGACGTCCGCGACGCGGAGCGGGTCGCCGCC
GACCACCCCGGTGTCGGCTACCGCGCCTTCGACCTGGGCGAGGCCGGGCCGGAGCGGATC
GGCGAGATGCTCGCCGAGGTCATCGCCCTCTTCGAGGACGGGGTGCTCCGGCACCTGCCC
GTCACGACCTGGGACGTGCGCCGGGCCCGCGACGCCTTCCGGCACGTCAGCCAGGCCCGC
CACACGGGCAAGGTCGTCCTCACGATGCCGTCGGGCCTCGACCCGGAGGGTACGGTCCTG
CTGACCGGCGGCACCGGTGCGCTGGGGGGCATCGTGGCCCGGCACGTGGTGGGCGAGTGG
GGCGTACGACGCCTGCTGCTCGTGAGCCGGCGGGGCACGGACGCCCCGGGCGCCGGCGAG
CTCGTGCACGAGCTGGAGGCCCTGGGAGCCGACGTCTCGGTGGCCGCGTGCGACGTCGCC
GACCGCGAAGCCCTCACCGCCGTACTCGACTCGATCCCCGCCGAACACCCGCTCACCGCG
GTCGTCCACACGGCAGGCGTCCTCTCCGACGGCACCCTCCCCTCGATGACAGCGGAGGAT
GTGGAACACGTACTGCGTCCCAAGGTCGACGCCGCGTTCCTCCTCGACGAACTCACCTCG
ACGCCCGGCTACGACCTGGCAGCGTTCGTCATGTTCTCCTCCGCCGCCGCCGTCTTCGGT
GGCGCGGGGCAGGGCGCCTACGCCGCCGCCAACGCCACCCTCGACGCCCTCGCCTGGCGC
CGCCGGACAGCCGGACTCCCCGCCCTCTCCCTCGGCTGGGGCCTCTGGGCCGAGACCAGC
GGCATGACCGGCGGACTCAGCGACACCGACCGCTCGCGGCTGGCCCGTTCCGGGGCGACG
CCCATGGACAGCGAGCTGACCCTGTCCCTCCTGGACGCGGCCATGCGCCGCGACGACCCG
GCGCTCGTCCCGATCGCCCTGGACGTCGCCGCGCTCCGCGCCCAGCAGCGCGACGGCATG
CTGGCGCCGCTGCTCAGCGGGCTCACCCGCGGATCGCGGGTCGGCGGCGCGCCGGTCAAC
CAGCGCAGGGCAGCCGCCGGAGGCGCGGGCGAGGCGGACACGGACCTCGGCGGGCGGCTC
GCCGCGATGACACCGGACGACCGGGTCGCGCACCTGCGGGACCTCGTCCGTACGCACGTG
GCGACCGTCCTGGGACACGGCACCCCGAGCCGGGTGGACCTGGAGCGGGCCTTCCGCGAC
ACCGGTTTCGACTCGCTCACCGCCGTCGAACTCCGCAACCGTCTCAACGCCGCGACCGGG
CTGCGGCTGCCGGCCACGCTGGTCTTCGACCACCCCACCCCGGGGGAGCTCGCCGGGCAC
CTGCTCGACGAACTCGCCACGGCCGCGGGCGGGTCCTGGGCGGAAGGCACCGGGTCCGGA
GACACGGCCTCGGCGACCGATCGGCAGACCACGGCGGCCCTCGCCGAACTCGACCGGCTG
GAAGGCGTGCTCGCCTCCCTCGCGCCCGCCGCCGGCGGCCGTCCGGAGCTCGCCGCCCGG
CTCAGGGCGCTGGCCGCGGCCCTGGGGGACGACGGCGACGACGCCACCGACCTGGACGAG
GCGTCCGACGACGACCTCTTCTCCTTCATCGACAAGGAGCTGGGCGACTCCGACTTCTGA
[3] KS36..412
[3] AT572..881
[3] methylmalonyl-CoA762..766
[3] kr1150..1345
[3] ACP1443..1517
[4] KS1539..1916
[4] AT2069..2379
[4] methylmalonyl-CoA2259..2263
[4] DH2428..2593
[4] ER2959..3267
[4] KR3277..3459
[4] ACP3572..3642
[3] KS106..1236
[3] AT1714..2643
[3] methylmalonyl-CoA2284..2298
[3] kr3448..4035
[3] ACP4327..4551
[4] KS4615..5748
[4] AT6205..7137
[4] methylmalonyl-CoA6775..6789
[4] DH7282..7779
[4] ER8875..9801
[4] KR9829..10377
[4] ACP10714..10926

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [561-694]  G3DSA:3.40.366.10 [762-872]  G3DSA:3.40.366.10 [2062-2191]  G3DSA:3.40.366.10 [2259-2369]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [3089-3110]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [1475-1490]  PS00012 [3600-3615]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1443-1517]  PS50075 [3572-3642]  PS50075
PS50075   ACP_DOMAIN
 [1444-1520]  6.00000000000001e-50 G3DSA:1.10.1200.10 [3571-3646]  6.00000000000001e-50 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1440-1556]  1.29999924468179e-27 SSF47336 [3564-3659]  6.39998633403535e-24 SSF47336
SSF47336   ACP_like
 [1450-1516]  5.8e-12 PF00550 [3575-3641]  1.9e-13 PF00550
PF00550   PP-binding
IPR011032 GroES-like (Domain)
 [2972-3107]  5.7999965385478e-34 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [3100-3191]  4.3e-16 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [2981-3036]  9.7e-09 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1150-1344]  1.09999999999999e-45 PF08659 [3277-3458]  4.2e-57 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [36-286]  1.10000000000001e-96 PF00109 [1539-1790]  2.59999999999995e-100 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [294-412]  1.6e-48 PF02801 [1798-1916]  3.80000000000003e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [572-881]  2.70000000000002e-99 PF00698 [2069-2379]  2.59999999999995e-100 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [4-29]  5.59999999999999e-11 PF08990
PF08990   Docking
 [6-36]  1.9000006847787e-06 SSF101173
SSF101173   Polyketide_synth_docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [569-861]  4.50001022902825e-62 SSF52151 [2066-2379]  4.10001399699315e-62 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [697-761]  9.59999914716171e-17 SSF55048 [2194-2258]  3.69999438558106e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [38-298]  G3DSA:3.40.47.10 [299-466]  5.90000000000008e-125 G3DSA:3.40.47.10 [1542-1802]  G3DSA:3.40.47.10 [1803-1969]  5.90000000000008e-125 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [28-466]  1.69998802370953e-103 SSF53901 [1539-1967]  6.40004254961849e-106 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1148-1351]  6e-57 G3DSA:3.40.50.720 [3052-3241]  3.40000000000004e-48 G3DSA:3.40.50.720 [3277-3462]  1.70000000000001e-50 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [199-215]  PS00606 [1703-1719]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [573-864]  1.59998835313644e-114 SM00827 [2070-2361]  3.30001976117415e-118 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1448-1520]  2.90000354677981e-36 SM00823 [3573-3645]  6.60002751141562e-38 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [2428-2593]  1.69998802370953e-92 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [38-466]  SM00825 [1542-1970]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1150-1345]  4.90001027782405e-20 SM00822 [3277-3459]  1.10000150671643e-55 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [2959-3267]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit