close all open/close all

CDS information : Pikro_00070


close this sectionLocation

Organism
StrainATCC 15439
Entry namePikromycin
Contig
Start / Stop / Direction36,989 / 37,834 / + [in whole cluster]
36,989 / 37,834 / + [in contig]
Location36989..37834 [in whole cluster]
36989..37834 [in contig]
TypeCDS
Length846 bp (281 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Producttype II thioesterase
Product (GenBank)thioesterase II PikAV
Gene
Gene (GenBank)pikAV
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
  • Pik TEII, medium chain-length thioesterase
Reference
ACC
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[10421766] Elucidating the mechanism of chain termination switching in the picromycin/methymycin polyketide synthase. (Chem Biol. , 1999)
[10676969] Alternative modular polyketide synthase expression controls macrolactone structure. (Nature. , 2000)
[10713461] Genetic architecture of the polyketide synthases for methymycin and pikromycin series macrolides. (Gene. , 2000)
[11223265] The Streptomyces venezuelae pikAV gene contains a transcription unit essential for expression of enzymes involved in glycosylation of narbonolide and 10-deoxymethynolide. (Gene. , 2001)
[12368286] Biochemical evidence for an editing role of thioesterase II in the biosynthesis of the polyketide pikromycin. (J Biol Chem. , 2002)

close this sectionSequence

selected fasta
>type II thioesterase [thioesterase II PikAV]
MTDRPLNVDSGLWIRRFHPAPNSAVRLVCLPHAGGSASYFFRFSEELHPSVEALSVQYPG
RQDRRAEPCLESVEELAEHVVAATEPWWQEGRLAFFGHSLGASVAFETARILEQRHGVRP
EGLYVSGRRAPSLAPDRLVHQLDDRAFLAEIRRLSGTDERFLQDDELLRLVLPALRSDYK
AAETYLHRPSAKLTCPVMALAGDRDPKAPLNEVAEWRRHTSGPFCLRAYSGGHFYLNDQW
HEICNDISDHLLVTRGAPDARVVQPPTSLIEGAAKRWQNPR
selected fasta
>type II thioesterase [thioesterase II PikAV]
GTGACCGACAGACCTCTGAACGTGGACAGCGGACTGTGGATCCGGCGCTTCCACCCCGCG
CCGAACAGCGCGGTGCGGCTGGTCTGCCTGCCGCACGCCGGCGGCTCCGCCAGCTACTTC
TTCCGCTTCTCGGAGGAGCTGCACCCCTCCGTCGAGGCCCTGTCGGTGCAGTATCCGGGC
CGCCAGGACCGGCGTGCCGAGCCGTGTCTGGAGAGCGTCGAGGAGCTCGCCGAGCATGTG
GTCGCGGCCACCGAACCCTGGTGGCAGGAGGGCCGGCTGGCCTTCTTCGGGCACAGCCTC
GGCGCCTCCGTCGCCTTCGAGACGGCCCGCATCCTGGAACAGCGGCACGGGGTACGGCCC
GAGGGCCTGTACGTCTCCGGTCGGCGCGCCCCGTCGCTGGCGCCGGACCGGCTCGTCCAC
CAGCTGGACGACCGGGCGTTCCTGGCCGAGATCCGGCGGCTCAGCGGCACCGACGAGCGG
TTCCTCCAGGACGACGAGCTGCTGCGGCTGGTGCTGCCCGCGCTGCGCAGCGACTACAAG
GCGGCGGAGACGTACCTGCACCGGCCGTCCGCCAAGCTCACCTGCCCGGTGATGGCCCTG
GCCGGCGACCGTGACCCGAAGGCGCCGCTGAACGAGGTGGCCGAGTGGCGTCGGCACACC
AGCGGGCCGTTCTGCCTCCGGGCGTACTCCGGCGGCCACTTCTACCTCAACGACCAGTGG
CACGAGATCTGCAACGACATCTCCGACCACCTGCTCGTCACCCGCGGCGCGCCCGATGCC
CGCGTCGTGCAGCCCCCGACCAGCCTTATCGAAGGAGCGGCGAAGAGATGGCAGAACCCA
CGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [26-251]  2.29999999999998e-55 PF00975
PF00975   Thioesterase
SignalP No significant hit
TMHMM No significant hit