close all open/close all

CDS information : Pikro_00080


close this sectionLocation

Organism
StrainATCC 15439
Entry namePikromycin
Contig
Start / Stop / Direction39,867 / 41,075 / + [in whole cluster]
119 / 1,327 / + [in contig]
Location39867..41075 [in whole cluster]
119..1327 [in contig]
TypeCDS
Length1,209 bp (402 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase helper protein
Product (GenBank)putative tautomerase
Gene
Gene (GenBank)desVIII
EC number
Keyword
  • desosamine
Note
Note (GenBank)
Reference
ACC
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[15161264] Characterization of the glycosyltransferase activity of desVII: analysis of and implications for the biosynthesis of macrolide antibiotics. (J Am Chem Soc. , 2004)
[15358425] New olivosyl derivatives of methymycin/pikromycin from an engineered strain of Streptomyces venezuelae. (FEMS Microbiol Lett. , 2004)
[20695498] Characterization of glycosyltransferase DesVII and its auxiliary partner protein DesVIII in the methymycin/picromycin biosynthetic pathway. (Biochemistry. , 2010)
[26552796] In vivo investigation to the macrolide-glycosylating enzyme pair DesVII/DesVIII in Saccharopolyspora erythraea. (Appl Microbiol Biotechnol. , 2016)

close this sectionSequence

selected fasta
>glycosyltransferase helper protein [putative tautomerase]
MTDDLTGALTQPPLGRTVRAVADRELGTHLLETRGIHWIHAANGDPYATVLRGQADDPYP
AYERVRARGALSFSPTGSWVTADHALAASILCSTDFGVSGADGVPVPQQVLSYGEGCPLE
REQVLPAAGDVPEGGQRAVVEGIHRETLEGLAPDPSASYAFELLGGFVRPAVTAAAAAVL
GVPADRRADFADLLERLRPLSDSLLAPQSLRTVRAADGALAELTALLADSDDSPGALLSA
LGVTAAVQLTGNAVLALLAHPEQWRELCDRPGLAAAAVEETLRYDPPVQLDARVVRGETE
LAGRRLPAGAHVVVLTAATGRDPEVFTDPERFDLARPDAAAHLALHPAGPYGPVASLVRL
QAEVALRTLAGRFPGLRQAGDVLRPRRAPVGRGPLSVPVSSS
selected fasta
>glycosyltransferase helper protein [putative tautomerase]
GTGACCGACGACCTGACGGGGGCCCTCACGCAGCCCCCGCTGGGCCGCACCGTCCGCGCG
GTGGCCGACCGTGAACTCGGCACCCACCTCCTGGAGACCCGCGGCATCCACTGGATCCAC
GCCGCGAACGGCGACCCGTACGCCACCGTGCTGCGCGGCCAGGCGGACGACCCGTATCCC
GCGTACGAGCGGGTGCGTGCCCGCGGCGCGCTCTCCTTCAGCCCGACGGGCAGCTGGGTC
ACCGCCGATCACGCCCTGGCGGCGAGCATCCTCTGCTCGACGGACTTCGGGGTCTCCGGC
GCCGACGGCGTCCCGGTGCCGCAGCAGGTCCTCTCGTACGGGGAGGGCTGTCCGCTGGAG
CGCGAGCAGGTGCTGCCGGCGGCCGGTGACGTGCCGGAGGGCGGGCAGCGTGCCGTGGTC
GAGGGGATCCACCGGGAGACGCTGGAGGGTCTCGCGCCGGACCCGTCGGCGTCGTACGCC
TTCGAGCTGCTGGGCGGTTTCGTCCGCCCGGCGGTGACGGCCGCTGCCGCCGCCGTGCTG
GGTGTTCCCGCGGACCGGCGCGCGGACTTCGCGGATCTGCTGGAGCGGCTCCGGCCGCTG
TCCGACAGCCTGCTGGCCCCGCAGTCCCTGCGGACGGTACGGGCGGCGGACGGCGCGCTG
GCCGAGCTCACGGCGCTGCTCGCCGATTCGGACGACTCCCCCGGGGCCCTGCTGTCGGCG
CTCGGGGTCACCGCAGCCGTCCAGCTCACCGGGAACGCGGTGCTCGCGCTCCTCGCGCAT
CCCGAGCAGTGGCGGGAGCTGTGCGACCGGCCCGGGCTCGCGGCGGCCGCGGTGGAGGAG
ACCCTCCGCTACGACCCGCCGGTGCAGCTCGACGCCCGGGTGGTCCGCGGGGAGACGGAG
CTGGCGGGCCGGCGGCTGCCGGCCGGGGCGCATGTCGTCGTCCTGACCGCCGCGACCGGC
CGGGACCCGGAGGTCTTCACGGACCCGGAGCGCTTCGACCTCGCGCGCCCCGACGCCGCC
GCGCACCTCGCGCTGCACCCCGCCGGTCCGTACGGCCCGGTGGCGTCCCTGGTCCGGCTT
CAGGCGGAGGTCGCGCTGCGGACCCTGGCCGGGCGTTTCCCCGGGCTGCGGCAGGCGGGG
GACGTGCTCCGCCCCCGCCGCGCGCCTGTCGGCCGCGGGCCGCTGAGCGTCCCGGTCAGC
AGCTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [274-340]  1.2e-13 PF00067
PF00067   p450
 [50-400]  3.60000000000002e-42 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [58-399]  1.60000240695997e-42 SSF48264
SSF48264   Cytochrome_P450
IPR002397 Cytochrome P450, B-class (Family)
 [179-194]  2.2999993566538e-05 PR00359 [321-336]  2.2999993566538e-05 PR00359
PR00359   BP450
SignalP No significant hit
TMHMM No significant hit