close all open/close all

CDS information : Pikro_00090


close this sectionLocation

Organism
StrainATCC 15439
Entry namePikromycin
Contig
Start / Stop / Direction41,223 / 42,503 / + [in whole cluster]
1,475 / 2,755 / + [in contig]
Location41223..42503 [in whole cluster]
1475..2755 [in contig]
TypeCDS
Length1,281 bp (426 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
Product (GenBank)glycosyl transferase
Gene
Gene (GenBank)desVII
EC number
Keyword
  • desosamine
Note
Note (GenBank)
Reference
ACC
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[15161264] Characterization of the glycosyltransferase activity of desVII: analysis of and implications for the biosynthesis of macrolide antibiotics. (J Am Chem Soc. , 2004)
[15358425] New olivosyl derivatives of methymycin/pikromycin from an engineered strain of Streptomyces venezuelae. (FEMS Microbiol Lett. , 2004)
[20695498] Characterization of glycosyltransferase DesVII and its auxiliary partner protein DesVIII in the methymycin/picromycin biosynthetic pathway. (Biochemistry. , 2010)
[23770075] Combinatorial biosynthesis and antibacterial evaluation of glycosylated derivatives of 12-membered macrolide antibiotic YC-17. (J Biotechnol. , 2013)
[26552796] In vivo investigation to the macrolide-glycosylating enzyme pair DesVII/DesVIII in Saccharopolyspora erythraea. (Appl Microbiol Biotechnol. , 2016)

close this sectionSequence

selected fasta
>glycosyltransferase [glycosyl transferase]
MRVLLTSFAHHTHYYGLVPLAWALLAAGHEVRVASQPALTDTITGSGLAAVPVGTDHLIH
EYRVRMAGEPRPNHPAIAFDEARPEPLDWDHALGIEAILAPYFHLLANNDSMVDDLVDFA
RSWQPDLVLWEPTTYAGAVAAQVTGAAHARVLWGPDVMGSARRKFVALRDRQPPEHREDP
TAEWLTWTLDRYGASFEEELLTGQFTIDPTPPSLRLDTGLPTVGMRYVPYNGTSVVPDWL
SEPPARPRVCLTLGVSAREVLGGDGVSQGDILEALADLDIELVATLDASQRAEIRNYPKH
TRFTDFVPMHALLPSCSAIIHHGGAGTYATAVINAVPQVMLAELWDAPVKARAVAEQGAG
FFLPPAELTPQAVRDAVVRILDDPSVATAAHRLREETFGDPTPAGIVPELERLAAQHRRP
PADARH
selected fasta
>glycosyltransferase [glycosyl transferase]
ATGCGCGTCCTGCTGACCTCGTTCGCACATCACACGCACTACTACGGCCTGGTGCCCCTG
GCCTGGGCGCTGCTCGCCGCCGGGCACGAGGTGCGGGTCGCCAGCCAGCCCGCGCTCACG
GACACCATCACCGGGTCCGGGCTCGCCGCGGTGCCGGTCGGCACCGACCACCTCATCCAC
GAGTACCGGGTGCGGATGGCGGGCGAGCCGCGCCCGAACCATCCGGCGATCGCCTTCGAC
GAGGCCCGTCCCGAGCCGCTGGACTGGGACCACGCCCTCGGCATCGAGGCGATCCTCGCC
CCGTACTTCCATCTGCTCGCCAACAACGACTCGATGGTCGACGACCTCGTCGACTTCGCC
CGGTCCTGGCAGCCGGACCTGGTGCTGTGGGAGCCGACGACCTACGCGGGCGCCGTCGCC
GCCCAGGTCACCGGTGCCGCGCACGCCCGGGTCCTGTGGGGGCCCGACGTGATGGGCAGC
GCCCGCCGCAAGTTCGTCGCGCTGCGGGACCGGCAGCCGCCCGAGCACCGCGAGGACCCC
ACCGCGGAGTGGCTGACGTGGACGCTCGACCGGTACGGCGCCTCCTTCGAAGAGGAGCTG
CTCACCGGCCAGTTCACGATCGACCCGACCCCGCCGAGCCTGCGCCTCGACACGGGCCTG
CCGACCGTCGGGATGCGTTATGTTCCGTACAACGGCACGTCGGTCGTGCCGGACTGGCTG
AGTGAGCCGCCCGCGCGGCCCCGGGTCTGCCTGACCCTCGGCGTCTCCGCGCGTGAGGTC
CTCGGCGGCGACGGCGTCTCGCAGGGCGACATCCTGGAGGCGCTCGCCGACCTCGACATC
GAGCTCGTCGCCACGCTCGACGCGAGTCAGCGCGCCGAGATCCGCAACTACCCGAAGCAC
ACCCGGTTCACGGACTTCGTGCCGATGCACGCGCTCCTGCCGAGCTGCTCGGCGATCATC
CACCACGGCGGGGCGGGCACCTACGCGACCGCCGTGATCAACGCGGTGCCGCAGGTCATG
CTCGCCGAGCTGTGGGACGCGCCGGTCAAGGCGCGGGCCGTCGCCGAGCAGGGGGCGGGG
TTCTTCCTGCCGCCGGCCGAGCTCACGCCGCAGGCCGTGCGGGACGCCGTCGTCCGCATC
CTCGACGACCCCTCGGTCGCCACCGCCGCGCACCGGCTGCGCGAGGAGACCTTCGGCGAC
CCCACCCCGGCCGGGATCGTCCCCGAGCTGGAGCGGCTCGCCGCGCAGCACCGCCGCCCG
CCGGCCGACGCCCGGCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-71]  1.4e-11 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [207-302]  2.29999999999998e-35 PF06722
PF06722   DUF1205
SignalP
 [1-35]  0.943 Signal
Eukaryota   
TMHMM No significant hit