close all open/close all

CDS information : Pikro_00100


close this sectionLocation

Organism
StrainATCC 15439
Entry namePikromycin
Contig
Start / Stop / Direction42,593 / 43,306 / + [in whole cluster]
2,845 / 3,558 / + [in contig]
Location42593..43306 [in whole cluster]
2845..3558 [in contig]
TypeCDS
Length714 bp (237 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductNDP-hexose N,N-dimethyltransferase
Product (GenBank)N,N-dimethyltransferase
Gene
Gene (GenBank)desVI
EC number2.1.1.-
Keyword
  • desosamine
Note
Note (GenBank)
Reference
ACC
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[12119032] Expression, purification, and characterization of two N,N-dimethyltransferases, tylM1 and desVI, involved in the biosynthesis of mycaminose and desosamine. (Biochemistry. , 2002)
Related Reference
ACC
Q9F836
NITE
Megalo_00060
PmId
[16514147] In vivo characterization of the dTDP-D-desosamine pathway of the megalomicin gene cluster from Micromonospora megalomicea. (Microbiology. , 2006)
[20418422] TDP-L-megosamine biosynthesis pathway elucidation and megalomicin a production in Escherichia coli. (Appl Environ Microbiol. , 2010)

close this sectionSequence

selected fasta
>NDP-hexose N,N-dimethyltransferase [N,N-dimethyltransferase]
MYEVDHADVYDLFYLGRGKDYAAEASDIADLVRSRTPEASSLLDVACGTGTHLEHFTKEF
GDTAGLELSEDMLTHARKRLPDATLHQGDMRDFRLGRKFSAVVSMFSSVGYLKTTEELGA
AVASFAEHLEPGGVVVVEPWWFPETFADGWVSADVVRRDGRTVARVSHSVREGNATRMEV
HFTVADPGKGVRHFSDVHLITLFHQAEYEAAFTAAGLRVEYLEGGPSGRGLFVGVPA
selected fasta
>NDP-hexose N,N-dimethyltransferase [N,N-dimethyltransferase]
GTGTACGAAGTCGACCACGCCGACGTCTACGACCTCTTCTACCTGGGTCGCGGCAAGGAC
TACGCCGCCGAGGCCTCCGACATCGCCGACCTGGTGCGCTCCCGTACCCCCGAGGCCTCC
TCGCTCCTGGACGTGGCCTGCGGTACGGGCACGCATCTGGAGCACTTCACCAAGGAGTTC
GGCGACACCGCCGGCCTGGAGCTGTCCGAGGACATGCTCACCCACGCCCGCAAGCGGCTG
CCCGACGCCACGCTCCACCAGGGCGACATGCGGGACTTCCGGCTCGGCCGGAAGTTCTCC
GCCGTGGTCAGCATGTTCAGCTCCGTCGGCTACCTGAAGACGACCGAGGAACTCGGCGCG
GCCGTCGCCTCGTTCGCGGAGCACCTGGAGCCCGGTGGCGTCGTCGTCGTCGAGCCGTGG
TGGTTCCCGGAGACCTTCGCCGACGGCTGGGTCAGCGCCGACGTCGTCCGCCGTGACGGG
CGCACCGTGGCCCGTGTCTCGCACTCGGTGCGGGAGGGGAACGCGACGCGCATGGAGGTC
CACTTCACCGTGGCCGACCCGGGCAAGGGCGTGCGGCACTTCTCCGACGTCCATCTCATC
ACCCTGTTCCACCAGGCCGAGTACGAGGCCGCGTTCACGGCCGCCGGGCTGCGCGTCGAG
TACCTGGAGGGCGGCCCGTCGGGCCGTGGCCTCTTCGTCGGCGTCCCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-39]  0.026 Signal
Bacteria, Gram-negative   
 [1-25]  0.077 Signal
Bacteria, Gram-positive   
TMHMM No significant hit