close all open/close all

CDS information : Pikro_00110


close this sectionLocation

Organism
StrainATCC 15439
Entry namePikromycin
Contig
Start / Stop / Direction43,373 / 45,802 / + [in whole cluster]
3,625 / 6,054 / + [in contig]
Location43373..45802 [in whole cluster]
3625..6054 [in contig]
TypeCDS
Length2,430 bp (809 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.4 resistance
Productbeta-glucosidase
Product (GenBank)beta-glucosidase
Gene
Gene (GenBank)desR
EC number3.2.1.21
Keyword
  • extracellular reactivation
Note
Note (GenBank)
  • putative extracellular protein involved in a resistance mechanism
Reference
ACC
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[14674753] Beta-glucosylation as a part of self-resistance mechanism in methymycin/pikromycin producing strain Streptomyces venezuelae. (Biochemistry. , 2003)
Related Reference
ACC
O68843
PmId
[9680207] Two glycosyltransferases and a glycosidase are involved in oleandomycin modification during its biosynthesis by Streptomyces antibioticus. (Mol Microbiol. , 1998)

close this sectionSequence

selected fasta
>beta-glucosidase [beta-glucosidase]
MTGKTRIPRVRRGRTTPRAFTLAVVGTLLAGTTVAAAAPGAADTANVQYTSRAAELVAQM
TLDEKISFVHWALDPDRQNVGYLPGVPRLGIPELRAADGPNGIRLVGQTATALPAPVALA
STFDDTMADSYGKVMGRDGRALNQDMVLGPMMNNIRVPHGGRNYETFSEDPLVSSRTAVA
QIKGIQGAGLMTTAKHFAANNQENNRFSVNANVDEQTLREIEFPAFEASSKAGAASFMCA
YNGLNGKPSCGNDELLNNVLRTQWGFQGWVMSDWLATPGTDAITKGLDQEMGVELPGDVP
KGEPSPPAKFFGEALKTAVLNGTVPEAAVTRSAERIVGQMEKFGLLLATPAPRPERDKAG
AQAVSRKVAENGAVLLRNEGQALPLAGDAGKSIAVIGPTAVDPKVTGLGSAHVVPDSAAA
PLDTIKARAGAGATVTYETGEETFGTQIPAGNLSPAFNQGHQLEPGKAGALYDGTLTVPA
DGEYRIAVRATGGYATVQLGSHTIEAGQVYGKVSSPLLKLTKGTHKLTISGFAMSATPLS
LELGWVTPAAADATIAKAVESARKARTAVVFAYDDGTEGVDRPNLSLPGTQDKLISAVAD
ANPNTIVVLNTGSSVLMPWLSKTRAVLDMWYPGQAGAEATAALLYGDVNPSGKLTQSFPA
AENQHAVAGDPTSYPGVDNQQTYREGIHVGYRWFDKENVKPLFPFGHGLSYTSFTQSAPT
VVRTSTGGLKVTVTVRNSGKRAGQEVVQAYLGASPNVTAPQAKKKLVGYTKVSLAAGEAK
TVTVNVDRRQLQTGSSSADLRGSATVNVW
selected fasta
>beta-glucosidase [beta-glucosidase]
GTGACAGGTAAGACCCGAATACCGCGTGTCCGCCGCGGCCGCACCACGCCCAGGGCCTTC
ACCCTGGCCGTCGTCGGCACCCTGCTGGCGGGCACCACCGTGGCGGCCGCCGCTCCCGGC
GCCGCCGACACGGCCAATGTTCAGTACACGAGCCGGGCGGCGGAGCTCGTCGCCCAGATG
ACGCTCGACGAGAAGATCAGCTTCGTCCACTGGGCGCTGGACCCCGACCGGCAGAACGTC
GGCTACCTTCCCGGCGTGCCGCGTCTGGGCATCCCGGAGCTGCGTGCCGCCGACGGCCCG
AACGGCATCCGCCTGGTGGGGCAGACCGCCACCGCGCTGCCCGCGCCGGTCGCCCTGGCC
AGCACCTTCGACGACACCATGGCCGACAGCTACGGCAAGGTCATGGGCCGCGACGGTCGC
GCGCTCAACCAGGACATGGTCCTGGGCCCGATGATGAACAACATCCGGGTGCCGCACGGC
GGCCGGAACTACGAGACCTTCAGCGAGGACCCCCTGGTCTCCTCGCGCACCGCGGTCGCC
CAGATCAAGGGCATCCAGGGTGCGGGTCTGATGACCACGGCCAAGCACTTCGCGGCCAAC
AACCAGGAGAACAACCGCTTCTCCGTGAACGCCAATGTCGACGAGCAGACGCTCCGCGAG
ATCGAGTTCCCGGCGTTCGAGGCGTCCTCCAAGGCCGGCGCGGCCTCCTTCATGTGTGCC
TACAACGGCCTCAACGGGAAGCCGTCCTGCGGCAACGACGAGCTCCTCAACAACGTGCTG
CGCACGCAGTGGGGCTTCCAGGGCTGGGTGATGTCCGACTGGCTCGCCACCCCGGGCACC
GACGCCATCACCAAGGGCCTCGACCAGGAGATGGGCGTCGAGCTCCCCGGCGACGTCCCG
AAGGGCGAGCCCTCGCCGCCGGCCAAGTTCTTCGGCGAGGCGCTGAAGACGGCCGTCCTG
AACGGCACGGTCCCCGAGGCGGCCGTGACGCGGTCGGCGGAGCGGATCGTCGGCCAGATG
GAGAAGTTCGGTCTGCTCCTCGCCACTCCGGCGCCGCGGCCCGAGCGCGACAAGGCGGGT
GCCCAGGCGGTGTCCCGCAAGGTCGCCGAGAACGGCGCGGTGCTCCTGCGCAACGAGGGC
CAGGCCCTGCCGCTCGCCGGTGACGCCGGCAAGAGCATCGCGGTCATCGGCCCGACGGCC
GTCGACCCCAAGGTCACCGGCCTGGGCAGCGCCCACGTCGTCCCGGACTCGGCGGCGGCG
CCACTCGACACCATCAAGGCCCGCGCGGGTGCGGGTGCGACGGTGACGTACGAGACGGGT
GAGGAGACCTTCGGGACGCAGATCCCGGCGGGGAACCTCAGCCCGGCGTTCAACCAGGGC
CACCAGCTCGAGCCGGGCAAGGCGGGGGCGCTGTACGACGGCACGCTGACCGTGCCCGCC
GACGGCGAGTACCGCATCGCGGTCCGTGCCACCGGTGGTTACGCCACGGTGCAGCTCGGC
AGCCACACCATCGAGGCCGGTCAGGTCTACGGCAAGGTGAGCAGCCCGCTCCTCAAGCTG
ACCAAGGGCACGCACAAGCTCACGATCTCGGGCTTCGCGATGAGTGCCACCCCGCTCTCC
CTGGAGCTGGGCTGGGTGACGCCGGCGGCGGCCGACGCGACGATCGCGAAGGCCGTGGAG
TCGGCGCGGAAGGCCCGTACGGCGGTCGTCTTCGCCTACGACGACGGCACCGAGGGCGTC
GACCGTCCGAACCTGTCGCTGCCGGGTACGCAGGACAAGCTGATCTCGGCTGTCGCGGAC
GCCAACCCGAACACGATCGTGGTCCTCAACACCGGTTCGTCGGTGCTGATGCCGTGGCTG
TCCAAGACCCGCGCGGTCCTGGACATGTGGTACCCGGGCCAGGCGGGCGCCGAGGCCACC
GCCGCGCTGCTCTACGGTGACGTCAACCCGAGCGGCAAGCTCACGCAGAGCTTCCCGGCC
GCCGAGAACCAGCACGCGGTCGCCGGCGACCCGACAAGCTACCCGGGCGTCGACAACCAG
CAGACGTACCGCGAGGGCATCCACGTCGGGTACCGCTGGTTCGACAAGGAGAACGTCAAG
CCGCTGTTCCCGTTCGGGCACGGCCTGTCGTACACCTCGTTCACGCAGAGCGCCCCGACC
GTCGTGCGTACGTCCACGGGTGGTCTGAAGGTCACGGTCACGGTCCGCAACAGCGGGAAG
CGCGCCGGCCAGGAGGTCGTCCAGGCGTACCTCGGTGCCAGCCCGAACGTGACGGCTCCG
CAGGCGAAGAAGAAGCTCGTGGGCTACACGAAGGTCTCGCTCGCCGCGGGCGAGGCGAAG
ACGGTGACGGTGAACGTCGACCGCCGTCAGCTGCAGACCGGTTCGTCCTCCGCCGACCTG
CGGGGCAGCGCCACGGTCAACGTCTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001764 Glycoside hydrolase, family 3, N-terminal (Domain)
 [49-350]  7.79999999999999e-97 G3DSA:3.20.20.300
G3DSA:3.20.20.300   Glyco_hydro_3_N
 [88-104]  3.89999861795218e-32 PR00133 [113-132]  3.89999861795218e-32 PR00133 [159-175]  3.89999861795218e-32 PR00133 [190-206]  3.89999861795218e-32 PR00133 [259-277]  3.89999861795218e-32 PR00133
PR00133   GLHYDRLASE3
 [58-337]  5.80000000000004e-85 PF00933
PF00933   Glyco_hydro_3
IPR002772 Glycoside hydrolase family 3 C-terminal domain (Domain)
 [361-442]  1.09999999999999e-62 G3DSA:3.40.50.1700 [557-714]  1.09999999999999e-62 G3DSA:3.40.50.1700
G3DSA:3.40.50.1700   G3DSA:3.40.50.1700
 [373-691]  8.70000000000003e-61 PF01915
PF01915   Glyco_hydro_3_C
 [373-714]  7.6999848053369e-50 SSF52279
SSF52279   Glyco_hydro_3_C
IPR011658 PA14 (Domain)
 [429-558]  6.59999852526375e-25 SM00758
SM00758   PA14
 [431-557]  6.19999999999999e-18 PF07691
PF07691   PA14
IPR017853 Glycoside hydrolase, superfamily (Domain)
 [38-372]  2.2999842048857e-85 SSF51445
SSF51445   Glyco_hydro_cat
SignalP
 [1-37]  1 Signal
Bacteria, Gram-negative   
 [1-37]  1 Signal
Bacteria, Gram-positive   
 [1-36]  0.971 Signal
Eukaryota   
TMHMM
 [20-42]  Transmembrane (i-o)
Transmembrane 1