close all open/close all

CDS information : Pikro_00120


close this sectionLocation

Organism
StrainATCC 15439
Entry namePikromycin
Contig
Start / Stop / Direction47,030 / 45,891 / - [in whole cluster]
7,282 / 6,143 / - [in contig]
Locationcomplement(45891..47030) [in whole cluster]
complement(6143..7282) [in contig]
TypeCDS
Length1,140 bp (379 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-3 aminotransferase
Product (GenBank)transaminase
Gene
Gene (GenBank)desV
EC number2.6.1.-
Keyword
  • desosamine
Note
Note (GenBank)
Reference
ACC
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[17456741] Molecular architecture of DesV from Streptomyces venezuelae: a PLP-dependent transaminase involved in the biosynthesis of the unusual sugar desosamine. (Protein Sci. , 2007)
Related Reference
ACC
Q9F837
NITE
Megalo_00050
PmId
[16514147] In vivo characterization of the dTDP-D-desosamine pathway of the megalomicin gene cluster from Micromonospora megalomicea. (Microbiology. , 2006)
[20418422] TDP-L-megosamine biosynthesis pathway elucidation and megalomicin a production in Escherichia coli. (Appl Environ Microbiol. , 2010)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 aminotransferase [transaminase]
MSSRAETPRVPFLDLKAAYEELRAETDAAIARVLDSGRYLLGPELEGFEAEFAAYCETDH
AVGVNSGMDALQLALRGLGIGPGDEVIVPSHTYIASWLAVSATGATPVPVEPHEDHPTLD
PLLVEKAITPRTRALLPVHLYGHPADMDALRELADRHGLHIVEDAAQAHGARYRGRRIGA
GSSVAAFSFYPGKNLGCFGDGGAVVTGDPELAERLRMLRNYGSRQKYSHETKGTNSRLDE
MQAAVLRIRLAHLDSWNGRRSALAAEYLSGLAGLPGIGLPVTAPDTDPVWHLFTVRTERR
DELRSHLDARGIDTLTHYPVPVHLSPAYAGEAPPEGSLPRAESFARQVLSLPIGPHLERP
QALRVIDAVREWAERVDQA
selected fasta
>putative NDP-hexose C-3 aminotransferase [transaminase]
GTGAGCAGCCGCGCCGAGACCCCCCGCGTCCCCTTCCTCGACCTCAAGGCCGCCTACGAG
GAGCTCCGCGCGGAGACCGACGCCGCGATCGCCCGCGTCCTCGACTCGGGGCGCTACCTC
CTCGGACCCGAACTCGAAGGATTCGAGGCGGAGTTCGCCGCGTACTGCGAGACGGACCAC
GCCGTCGGCGTGAACAGCGGGATGGACGCCCTCCAGCTCGCCCTCCGCGGCCTCGGCATC
GGACCCGGGGACGAGGTGATCGTCCCCTCGCACACGTACATCGCCAGCTGGCTCGCGGTG
TCCGCCACCGGCGCGACCCCCGTGCCCGTCGAGCCGCACGAGGACCACCCCACCCTGGAC
CCGCTGCTCGTCGAGAAGGCGATCACCCCCCGCACCCGGGCGCTCCTCCCCGTCCACCTC
TACGGGCACCCCGCCGACATGGACGCCCTCCGCGAGCTCGCGGACCGGCACGGCCTGCAC
ATCGTCGAGGACGCCGCGCAGGCCCACGGCGCCCGCTACCGGGGCCGGCGGATCGGCGCC
GGGTCGTCGGTGGCCGCGTTCAGCTTCTACCCGGGCAAGAACCTCGGCTGCTTCGGCGAC
GGCGGCGCCGTCGTCACCGGCGACCCCGAGCTCGCCGAACGGCTCCGGATGCTCCGCAAC
TACGGCTCGCGGCAGAAGTACAGCCACGAGACGAAGGGCACCAACTCCCGCCTGGACGAG
ATGCAGGCCGCCGTGCTGCGGATCCGGCTCGCCCACCTGGACAGCTGGAACGGCCGCAGG
TCGGCGCTGGCCGCGGAGTACCTCTCCGGGCTCGCCGGACTGCCCGGCATCGGCCTGCCG
GTGACCGCGCCCGACACCGACCCGGTCTGGCACCTCTTCACCGTGCGCACCGAGCGCCGC
GACGAGCTGCGCAGCCACCTCGACGCCCGCGGCATCGACACCCTCACGCACTACCCGGTA
CCCGTGCACCTCTCGCCCGCCTACGCGGGCGAGGCACCGCCGGAAGGCTCGCTCCCGCGG
GCCGAGAGCTTCGCGCGGCAGGTCCTCAGCCTGCCGATCGGCCCGCACCTGGAGCGCCCG
CAGGCGCTGCGGGTGATCGACGCCGTGCGCGAATGGGCCGAGCGGGTCGACCAGGCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [22-370]  3.60000000000002e-125 PF01041
PF01041   DegT_DnrJ_EryC1
 [1-377]  PIRSF000390
PIRSF000390   PLP_StrS
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [10-251]  4.80000000000003e-91 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [253-375]  5.10000000000004e-39 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [6-376]  4.89996723796399e-112 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit