close all open/close all

CDS information : Pikro_00130


close this sectionLocation

Organism
StrainATCC 15439
Entry namePikromycin
Contig
Start / Stop / Direction48,040 / 47,027 / - [in whole cluster]
8,292 / 7,279 / - [in contig]
Locationcomplement(47027..48040) [in whole cluster]
complement(7279..8292) [in contig]
TypeCDS
Length1,014 bp (337 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-glucose 4,6-dehydratase
Product (GenBank)TDP-glucose-4,6-dehydratase
Gene
Gene (GenBank)desIV
EC number4.2.1.46
Keyword
  • desosamine
Note
Note (GenBank)
Reference
ACC
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[14570895] High resolution X-ray structure of dTDP-glucose 4,6-dehydratase from Streptomyces venezuelae. (J Biol Chem. , 2004)

close this sectionSequence

selected fasta
>dTDP-glucose 4,6-dehydratase [TDP-glucose-4,6-dehydratase]
MRLLVTGGAGFIGSHFVRQLLAGAYPDVPADEVIVLDSLTYAGNRANLAPVDADPRLRFV
HGDIRDAGLLARELRGVDAIVHFAAESHVDRSIAGASVFTETNVQGTQTLLQCAVDAGVG
RVVHVSTDEVYGSIDSGSWTESSPLEPNSPYAASKAGSDLVARAYHRTYGLDVRITRCCN
NYGPYQHPEKLIPLFVTNLLDGGTLPLYGDGANVREWVHTDDHCRGIALVLAGGRAGEIY
HIGGGLELTNRELTGILLDSLGADWSSVRKVADRKGHDLRYSLDGGEIERELGYRPQVSF
ADGLARTVRWYRENRGWWEPLKATAPQLPATAVEVSA
selected fasta
>dTDP-glucose 4,6-dehydratase [TDP-glucose-4,6-dehydratase]
GTGCGGCTTCTGGTGACCGGAGGTGCGGGCTTCATCGGCTCGCACTTCGTGCGGCAGCTC
CTCGCCGGGGCGTACCCCGACGTGCCCGCCGATGAGGTGATCGTCCTGGACAGCCTCACC
TACGCGGGCAACCGCGCCAACCTCGCCCCGGTGGACGCGGACCCGCGACTGCGCTTCGTC
CACGGCGACATCCGCGACGCCGGCCTCCTCGCCCGGGAACTGCGCGGCGTGGACGCCATC
GTCCACTTCGCGGCCGAGAGCCACGTGGACCGCTCCATCGCGGGCGCGTCCGTGTTCACC
GAGACCAACGTGCAGGGCACGCAGACGCTGCTCCAGTGCGCCGTCGACGCCGGCGTCGGC
CGGGTCGTGCACGTCTCCACCGACGAGGTGTACGGGTCGATCGACTCCGGCTCCTGGACC
GAGAGCAGCCCGCTGGAGCCCAACTCGCCCTACGCGGCGTCCAAGGCCGGCTCCGACCTC
GTTGCCCGCGCCTACCACCGGACGTACGGCCTCGACGTACGGATCACCCGCTGCTGCAAC
AACTACGGGCCGTACCAGCACCCCGAGAAGCTCATCCCCCTCTTCGTGACGAACCTCCTC
GACGGCGGGACGCTCCCGCTGTACGGCGACGGCGCGAACGTCCGCGAGTGGGTGCACACC
GACGACCACTGCCGGGGCATCGCGCTCGTCCTCGCGGGCGGCCGGGCCGGCGAGATCTAC
CACATCGGCGGCGGCCTGGAGCTGACCAACCGCGAACTCACCGGCATCCTCCTGGACTCG
CTCGGCGCCGACTGGTCCTCGGTCCGGAAGGTCGCCGACCGCAAGGGCCACGACCTGCGC
TACTCCCTCGACGGCGGCGAGATCGAGCGCGAGCTCGGCTACCGCCCGCAGGTCTCCTTC
GCGGACGGCCTCGCGCGGACCGTCCGCTGGTACCGGGAGAACCGCGGCTGGTGGGAGCCG
CTCAAGGCGACCGCCCCGCAGCTGCCCGCCACCGCCGTGGAGGTGTCCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [4-243]  9.9e-65 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [2-321]  7.99999999999993e-127 TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [1-199]  1.10000000000001e-65 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [138-166]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-22]  0.798 Signal
Eukaryota   
TMHMM No significant hit