close all open/close all

CDS information : Pikro_00140


close this sectionLocation

Organism
StrainATCC 15439
Entry namePikromycin
Contig
Start / Stop / Direction49,050 / 48,172 / - [in whole cluster]
9,302 / 8,424 / - [in contig]
Locationcomplement(48172..49050) [in whole cluster]
complement(8424..9302) [in contig]
TypeCDS
Length879 bp (292 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)alpha-D-glucose-1-phosphate thymidylyltransferase
Gene
Gene (GenBank)desIII
EC number2.7.7.24
Keyword
  • desosamine
Note
Note (GenBank)
Reference
ACC
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
Related Reference
ACC
Q9AGY4
PmId
[12147463] Homologs of the Rml enzymes from Salmonella enterica are responsible for dTDP-beta-L-rhamnose biosynthesis in the gram-positive thermophile Aneurinibacillus thermoaerophilus DSM 10155. (Appl Environ Microbiol. , 2002)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [alpha-D-glucose-1-phosphate thymidylyltransferase]
MKGIVLAGGSGTRLHPATSVISKQILPVYNKPMIYYPLSVLMLGGIREIQIISTPQHIEL
FQSLLGNGRHLGIELDYAVQKEPAGIADALLVGAEHIGDDTCALILGDNIFHGPGLYTLL
RDSIARLDGCVLFGYPVKDPERYGVAEVDATGRLTDLVEKPVKPRSNLAVTGLYLYDNDV
VDIAKNIRPSPRGELEITDVNRVYLERGRAELVNLGRGFAWLDTGTHDSLLRAAQYVQVL
EERQGVWIAGLEEIAFRMGFIDAEACHGLGEGLSRTEYGSYLMEIAGREGAP
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [alpha-D-glucose-1-phosphate thymidylyltransferase]
ATGAAGGGAATAGTCCTGGCCGGCGGGAGCGGAACTCGGCTGCATCCGGCGACCTCGGTC
ATTTCGAAGCAGATTCTTCCGGTCTACAACAAACCGATGATCTACTATCCGCTGTCGGTT
CTCATGCTCGGCGGTATTCGCGAGATTCAAATCATCTCGACCCCCCAGCACATCGAACTC
TTCCAGTCGCTTCTCGGAAACGGCAGGCACCTGGGAATAGAACTCGACTATGCGGTCCAG
AAAGAGCCCGCAGGAATCGCGGACGCACTTCTCGTCGGAGCCGAGCACATCGGCGACGAC
ACCTGCGCCCTGATCCTGGGCGACAACATCTTCCACGGGCCCGGCCTCTACACGCTCCTG
CGGGACAGCATCGCGCGCCTCGACGGCTGCGTGCTCTTCGGCTACCCGGTCAAGGACCCC
GAGCGGTACGGCGTCGCCGAGGTGGACGCGACGGGCCGGCTGACCGACCTCGTCGAGAAG
CCCGTCAAGCCGCGCTCCAACCTCGCCGTCACCGGCCTCTACCTCTACGACAACGACGTC
GTCGACATCGCCAAGAACATCCGGCCCTCGCCGCGCGGCGAGCTGGAGATCACCGACGTC
AACCGCGTCTACCTGGAGCGGGGCCGGGCCGAACTCGTCAACCTGGGCCGCGGCTTCGCC
TGGCTGGACACCGGCACCCACGACTCGCTCCTGCGGGCCGCCCAGTACGTCCAGGTCCTG
GAGGAGCGGCAGGGCGTCTGGATCGCGGGCCTTGAGGAGATCGCCTTCCGCATGGGCTTC
ATCGACGCCGAGGCCTGTCACGGCCTGGGAGAAGGCCTCTCCCGCACCGAGTACGGCAGC
TATCTGATGGAGATCGCCGGCCGCGAGGGAGCCCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [2-237]  1.6e-62 PF00483
PF00483   NTP_transferase
IPR005907 Glucose-1-phosphate thymidylyltransferase, short form (Family)
 [2-286]  5.00000000000001e-127 TIGR01207
TIGR01207   RmlA
SignalP No significant hit
TMHMM No significant hit