close all open/close all

CDS information : Pikro_00150


close this sectionLocation

Organism
StrainATCC 15439
Entry namePikromycin
Contig
Start / Stop / Direction50,700 / 49,243 / - [in whole cluster]
10,952 / 9,495 / - [in contig]
Locationcomplement(49243..50700) [in whole cluster]
complement(9495..10952) [in contig]
TypeCDS
Length1,458 bp (485 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductSAM-dependent NDP-hexose C-4 deaminase/C-3 dehydrogenase
Product (GenBank)putative reductase
Gene
Gene (GenBank)desII
EC number
Keyword
  • desosamine
Note
  • This dehydrogenation function is not involved in desosamine biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[19746907] Characterization and mechanistic studies of DesII: a radical S-adenosyl-L-methionine enzyme involved in the biosynthesis of TDP-D-desosamine. (J Am Chem Soc. , 2009)
[20121093] Stoichiometry of the redox neutral deamination and oxidative dehydrogenation reactions catalyzed by the radical SAM enzyme DesII. (J Am Chem Soc. , 2010)
[23329328] EPR-kinetic isotope effect study of the mechanism of radical-mediated dehydrogenation of an alcohol by the radical SAM enzyme DesII. (Proc Natl Acad Sci U S A. , 2013)
[25826575] Mechanistic Investigation of the Radical S-Adenosyl-L-methionine Enzyme DesII Using Fluorinated Analogues. (J Am Chem Soc. , 2015)

close this sectionSequence

selected fasta
>SAM-dependent NDP-hexose C-4 deaminase/C-3 dehydrogenase [putative reductase]
MTAPALSATAPAERCAHPGADLGAAVHAVGQTLAAGGLVPPDEAGTTARHLVRLAVRYGN
SPFTPLEEARHDLGVDRDAFRRLLALFGQVPELRTAVETGPAGAYWKNTLLPLEQRGVFD
AALARKPVFPYSVGLYPGPTCMFRCHFCVRVTGARYDPSALDAGNAMFRSVIDEIPAGNP
SAMYFSGGLEPLTNPGLGSLAAHATDHGLRPTVYTNSFALTERTLERQPGLWGLHAIRTS
LYGLNDEEYEQTTGKKAAFRRVRENLRRFQQLRAERESPINLGFAYIVLPGRASRLLDLV
DFIADLNDAGQGRTIDFVNIREDYSGRDDGKLPQEERAELQEALNAFEERVRERTPGLHI
DYGYALNSLRTGADAELLRIKPATMRPTAHPQVAVQVDLLGDVYLYREAGFPDLDGATRY
IAGRVTPDTSLTEVVRDFVERGGEVAAVDGDEYFMDGFDQVVTARLNQLERDAADGWEEA
RGFLR
selected fasta
>SAM-dependent NDP-hexose C-4 deaminase/C-3 dehydrogenase [putative reductase]
ATGACCGCCCCCGCCCTTTCCGCCACCGCCCCGGCCGAACGCTGCGCGCACCCCGGAGCC
GATCTGGGGGCGGCGGTCCACGCCGTCGGCCAGACCCTCGCCGCCGGCGGCCTCGTGCCG
CCCGACGAGGCCGGAACGACCGCCCGCCACCTCGTCCGGCTCGCCGTGCGCTACGGCAAC
AGCCCCTTCACCCCGCTGGAGGAGGCCCGCCACGACCTGGGCGTCGACCGGGACGCCTTC
CGGCGCCTCCTCGCCCTGTTCGGGCAGGTCCCGGAGCTCCGCACCGCGGTCGAGACCGGC
CCCGCCGGGGCGTACTGGAAGAACACCCTGCTCCCGCTCGAACAGCGCGGCGTCTTCGAC
GCGGCGCTCGCCAGGAAGCCCGTCTTCCCGTACAGCGTCGGCCTCTACCCCGGCCCGACC
TGCATGTTCCGCTGCCACTTCTGCGTCCGTGTGACCGGCGCCCGCTACGACCCGTCCGCC
CTCGACGCCGGCAACGCCATGTTCCGGTCGGTCATCGACGAGATACCCGCGGGCAACCCC
TCGGCGATGTACTTCTCCGGCGGCCTGGAGCCGCTCACCAACCCCGGCCTCGGGAGCCTG
GCCGCGCACGCCACCGACCACGGCCTGCGGCCCACCGTCTACACGAACTCCTTCGCGCTC
ACCGAGCGCACCCTGGAGCGCCAGCCCGGCCTCTGGGGCCTGCACGCCATCCGCACCTCG
CTCTACGGCCTCAACGACGAGGAGTACGAGCAGACCACCGGCAAGAAGGCCGCCTTCCGC
CGCGTCCGCGAGAACCTGCGCCGCTTCCAGCAGCTGCGCGCCGAGCGCGAGTCGCCGATC
AACCTCGGCTTCGCCTACATCGTGCTCCCGGGCCGTGCCTCCCGCCTGCTCGACCTGGTC
GACTTCATCGCCGACCTCAACGACGCCGGGCAGGGCAGGACGATCGACTTCGTCAACATT
CGCGAGGACTACAGCGGCCGTGACGACGGCAAGCTGCCGCAGGAGGAGCGGGCCGAGCTC
CAGGAGGCCCTCAACGCCTTCGAGGAGCGGGTCCGCGAGCGCACCCCCGGACTCCACATC
GACTACGGCTACGCCCTGAACAGCCTGCGCACCGGGGCCGACGCCGAACTGCTGCGGATC
AAGCCCGCCACCATGCGGCCCACCGCGCACCCGCAGGTCGCGGTGCAGGTCGATCTCCTC
GGCGACGTGTACCTGTACCGCGAGGCCGGCTTCCCCGACCTGGACGGCGCGACCCGCTAC
ATCGCGGGCCGCGTGACCCCCGACACCTCCCTCACCGAGGTCGTCAGGGACTTCGTCGAG
CGCGGCGGCGAGGTGGCGGCCGTCGACGGCGACGAGTACTTCATGGACGGCTTCGATCAG
GTCGTCACCGCCCGCCTGAACCAGCTGGAGCGCGACGCCGCGGACGGCTGGGAGGAGGCC
CGCGGCTTCCTGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR016863 Reductase, EryCV, predicted (Family)
 [1-485]  PIRSF027982
PIRSF027982   Reductase_EryCV_prd
SignalP No significant hit
TMHMM No significant hit