close all open/close all

CDS information : Pikro_00160


close this sectionLocation

Organism
StrainATCC 15439
Entry namePikromycin
Contig
Start / Stop / Direction51,944 / 50,697 / - [in whole cluster]
12,196 / 10,949 / - [in contig]
Locationcomplement(50697..51944) [in whole cluster]
complement(10949..12196) [in contig]
TypeCDS
Length1,248 bp (415 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 aminotransferase
Product (GenBank)4-dehydrase
Gene
Gene (GenBank)desI
EC number2.6.1.-
Keyword
  • desosamine
Note
Note (GenBank)
Reference
ACC
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[17630700] Molecular architecture of DesI: a key enzyme in the biosynthesis of desosamine. (Biochemistry. , 2007)
Related Reference
PmId
[16514147] In vivo characterization of the dTDP-D-desosamine pathway of the megalomicin gene cluster from Micromonospora megalomicea. (Microbiology. , 2006)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 aminotransferase [4-dehydrase]
MKSALSDLAFFGGPAAFDQPLLVGRPNRIDRARLYERLDRALDSQWLSNGGPLVREFEER
VAGLAGVRHAVATCNATAGLQLLAHAAGLTGEVIMPSMTFAATPHALRWIGLTPVFADID
PDTGNLDPDQVAAAVTPRTSAVVGVHLWGRPCAADQLRKVADEHGLRLYFDAAHALGCAV
DGRPAGSLGDAEVFSFHATKAVNAFEGGAVVTDDADLAARIRALHNFGFDLPGGSPAGGT
NAKMSEAAAAMGLTSLDAFPEVIDRNRRNHAAYREHLADLPGVLVADHDRHGLNNHQYVI
VEIDEATTGIHRDLVMEVLKAEGVHTRAYFSPGCHELEPYRGQPHAPLPHTERLAARVLS
LPTGTAIGDDDIRRVADLLRLCATRGRELTARHRDTAPAPLAAPQTSTPTIGRSR
selected fasta
>putative NDP-hexose C-4 aminotransferase [4-dehydrase]
GTGAAAAGCGCCTTATCCGACCTCGCATTCTTCGGCGGCCCCGCCGCTTTCGACCAGCCG
CTCCTCGTGGGGCGGCCCAACCGCATCGACCGCGCCAGGCTGTACGAGCGGCTCGACCGG
GCCCTCGACAGCCAGTGGCTGTCCAACGGCGGCCCGCTCGTCCGCGAGTTCGAGGAGCGC
GTCGCCGGGCTCGCCGGGGTCCGGCATGCCGTGGCCACCTGCAACGCCACGGCCGGGCTC
CAGCTCCTCGCGCACGCCGCCGGCCTCACCGGCGAAGTGATCATGCCGTCGATGACGTTC
GCCGCCACCCCGCACGCACTGCGCTGGATCGGCCTCACCCCGGTCTTCGCCGACATCGAC
CCGGACACCGGCAACCTCGACCCGGACCAGGTGGCCGCCGCGGTCACACCCCGCACCTCG
GCCGTCGTCGGCGTCCACCTCTGGGGCCGCCCCTGCGCCGCCGACCAGCTGCGGAAGGTC
GCCGACGAGCACGGCCTGCGGCTGTACTTCGACGCCGCGCACGCCCTCGGCTGCGCGGTC
GACGGCCGGCCCGCCGGCAGCCTCGGCGACGCCGAGGTCTTCAGCTTCCACGCCACCAAG
GCCGTCAACGCCTTCGAGGGCGGCGCCGTCGTCACCGACGACGCCGACCTCGCCGCCCGG
ATCCGCGCCCTCCACAACTTCGGCTTCGACCTGCCCGGCGGCAGCCCCGCCGGCGGGACC
AACGCCAAGATGAGCGAGGCCGCCGCCGCCATGGGCCTCACCTCCCTCGACGCGTTTCCC
GAGGTCATCGACCGGAACCGGCGCAACCACGCCGCCTACCGCGAGCACCTCGCGGACCTC
CCCGGCGTCCTCGTCGCCGACCACGACCGCCACGGCCTCAACAACCACCAGTACGTGATC
GTCGAGATCGACGAGGCCACCACCGGCATCCACCGCGACCTCGTCATGGAGGTCCTGAAG
GCCGAAGGCGTGCACACCCGCGCCTACTTCTCGCCGGGCTGCCACGAGCTGGAGCCGTAC
CGCGGGCAGCCGCACGCCCCGCTGCCGCACACCGAACGCCTCGCCGCGCGCGTGCTGTCC
CTGCCGACCGGCACCGCCATCGGCGACGACGACATCCGCCGGGTCGCCGACCTGCTGCGT
CTCTGCGCGACCCGCGGCCGCGAACTGACCGCGCGCCACCGCGACACGGCCCCCGCCCCG
CTCGCGGCCCCCCAGACATCCACGCCCACGATTGGACGCTCCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [34-379]  2.59999999999995e-104 PF01041
PF01041   DegT_DnrJ_EryC1
 [1-387]  1.19999063421924e-121 PIRSF000390
PIRSF000390   PLP_StrS
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [32-257]  1.2e-64 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [260-383]  3e-27 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [31-380]  1.09999184471405e-90 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit